CoraLite® Plus 488-conjugated PPP2R2A/B/C Monoclonal antibody

PPP2R2A/B/C Monoclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-67783
Clone No.2E1D5

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig, rabbit

Applications

IF/ICC, FC (Intra)

PPP2R2B, 2E1D5, B55 BETA, B55β, PP2A B55BETA

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inSH-SY5Y cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67783 targets PPP2R2A/B/C in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat, pig, rabbit samples.

Tested Reactivity human, mouse, rat, pig, rabbit
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag30774

Product name: Recombinant human PPP2R2B protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 290-443 aa of BC031790

Sequence: SHSGRYIMTRDYLTVKVWDLNMENRPIETYQVHDYLRSKLCSLYENDCIFDKFECVWNGSDSVIMTGSYNNFFRMFDRNTKRDVTLEASRENSKPRAILKPRKVCVGGKRRKDEISVDSLDFSKKILHTAWHPSENIIAVAATNNLYIFQDKVN

Predict reactive species
Full Name protein phosphatase 2 (formerly 2A), regulatory subunit B, beta isoform
Calculated Molecular Weight 443 aa, 52 kDa
Observed Molecular Weight52 kDa
GenBank Accession NumberBC031790
Gene Symbol PPP2R2B
Gene ID (NCBI) 5521
RRIDAB_2923791
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ00005
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

The PPP2R2B gene encodes a deduced 443-amino acid protein of approximately 52 kDa,which is a brain-specific regulatory subunit B of protein phosphatase 2. PPP2R2B is a Subunit of PP2A, a highly conserved constitutive enzyme(PMID:11719278). PPP2R2B (Bβ) is an important regulator of protein phosphatase 2A (PP2A) activity in the brain. Through differential promoter usage and alternative splicing, two major isoforms Bβ1 and Bβ2 with divergent sub-cellular targeting N termini are produced. Bβ plays an important role in neuronal survival. It has 5 isoforms produced by alternative splicing.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 PPP2R2A/B/C antibody CL488-67783Download protocol
IF protocol for CL Plus 488 PPP2R2A/B/C antibody CL488-67783Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...