PPP3CA Polyclonal antibody

PPP3CA Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA
Cat No. 13422-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (3)

Applications

WB, IHC, IF/ICC, FC (Intra), IP, ELISA

CALNA, Calcineurin A alpha, Calmodulin-dependent calcineurin A subunit alpha isoform, CALN, CALNA1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse skeletal muscle tissue, RAW 264.7 cells, mouse heart tissue, SH-SY5Y cells
Positive IP detected inmouse brain tissue
Positive IHC detected inhuman colon cancer tissue, human cervical cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inSH-SY5Y cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:8000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

13422-1-AP targets PPP3CA in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, pig, monkey, chicken
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag4203

Product name: Recombinant human PPP3CA protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 3-302 aa of BC025714

Sequence: EPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSL

Predict reactive species
Full Name protein phosphatase 3 (formerly 2B), catalytic subunit, alpha isoform
Calculated Molecular Weight 59 kDa
Observed Molecular Weight 59 kDa
GenBank Accession NumberBC025714
Gene Symbol PPP3CA
Gene ID (NCBI) 5530
RRIDAB_2168314
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ08209
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PPP3CA, also called calcineurin Aα, is the only serine/threonine protein phosphatase under the control of Ca2+/calmodulin, and plays a critical role in the coupling of Ca2+ signals to cellular responses. Ca2+ signaling plays a central role in hypertrophic growth of cardiac and skeletal muscle in response to mechanical load and a variety of signals. Therefore, PPP3CA plays an important role in muscle differentiation, especially in muscle fiber type conversion. It is also involved in osteoclast regulation, regulating bone formation through an effect on osteoblast differentiation.

Protocols

Product Specific Protocols
FC protocol for PPP3CA antibody 13422-1-APDownload protocol
IF protocol for PPP3CA antibody 13422-1-APDownload protocol
IHC protocol for PPP3CA antibody 13422-1-APDownload protocol
IP protocol for PPP3CA antibody 13422-1-APDownload protocol
WB protocol for PPP3CA antibody 13422-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Mol Psychiatry

A recurrent SHANK1 mutation implicated in autism spectrum disorder causes autistic-like core behaviors in mice via downregulation of mGluR1-IP3R1-calcium signaling.

Authors - Yue Qin
mouseWB

J Adv Res

Transducin-like enhancer of split 3 protects against lipopolysaccharide-induced inflammation through DDX5-ATF1-PPP2R5A signaling

Authors - Di Fan
mouseWB

Proc Natl Acad Sci U S A

Major contribution of the 3/6/7 class of TRPC channels to myocardial ischemia/reperfusion and cellular hypoxia/reoxygenation injuries.

Authors - Xiju He
pigWB

J Agric Food Chem

Dietary Taurine Supplementation Improves the Meat Quality, Muscle Fiber Type, and Mitochondrial Function of Finishing Pigs

Authors - Wenting An
pigWB

J Cell Physiol

Taurine promotes muscle fiber type transformation through CaN/NFATc1 signaling in porcine myoblasts

Authors - Wenting An
humanWB,IF

Neurobiol Dis

Calcineurin β protects brain after injury by activating the unfolded protein response.

Authors - Yanan Chen

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

nuo (Verified Customer) (08-22-2021)

A very good ab to probe PPP3CA by WB. With a high titer.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:3000
  • Cell Tissue Type: mouse brain lysate
PPP3CA Antibody Western Blot validation (1:3000 dilution) in mouse brain lysate (Cat no:13422-1-AP)
Loading...
||
New chat Able
正在加载,请稍候...