CoraLite® Plus 647-conjugated PPP3CA Polyclonal antibody

PPP3CA Polyclonal Antibody for FC (Intra)
Cat No. CL647-13422

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

FC (Intra)

CALNA, Calcineurin A alpha, Calmodulin-dependent calcineurin A subunit alpha isoform, CALN, CALNA1

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 647
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL647-13422 targets PPP3CA in FC (Intra) applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag4203

Product name: Recombinant human PPP3CA protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 3-302 aa of BC025714

Sequence: EPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSL

Predict reactive species
Full Name protein phosphatase 3 (formerly 2B), catalytic subunit, alpha isoform
Calculated Molecular Weight 59 kDa
Observed Molecular Weight 59 kDa
GenBank Accession NumberBC025714
Gene Symbol PPP3CA
Gene ID (NCBI) 5530
RRIDAB_2934886
Conjugate CoraLite® Plus 647 Fluorescent Dye
Excitation/Emission Maxima Wavelengths654 nm / 674 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ08209
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

PPP3CA, also called calcineurin Aα, is the only serine/threonine protein phosphatase under the control of Ca2+/calmodulin, and plays a critical role in the coupling of Ca2+ signals to cellular responses. Ca2+ signaling plays a central role in hypertrophic growth of cardiac and skeletal muscle in response to mechanical load and a variety of signals. Therefore, PPP3CA plays an important role in muscle differentiation, especially in muscle fiber type conversion. It is also involved in osteoclast regulation, regulating bone formation through an effect on osteoblast differentiation.

Protocols

Product Specific Protocols
FC protocol for CL Plus 647 PPP3CA antibody CL647-13422Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...