PRKACA Monoclonal antibody, PBS Only

• 

  WB analysis of HeLa using 67491-1-Ig (same clone as 67491-1-PBS)

  WB result of PRKACA antibody (67491-1-Ig; 1:10000; incubated at room temperature for 1.5 hours) with sh-Control and sh-PRKACA transfected HeLa cells. This data was developed using the same antibody clone with 67491-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 67491-1-Ig (same clone as 67491-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67491-1-Ig (PRKACA antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67491-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 67491-1-Ig (same clone as 67491-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67491-1-Ig (PRKACA antibody) at dilution of 1:2300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67491-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 67491-1-Ig (same clone as 67491-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67491-1-Ig (PRKACA antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67491-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 67491-1-Ig (same clone as 67491-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67491-1-Ig (PRKACA antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67491-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 67491-1-Ig (same clone as 67491-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 67491-1-Ig (PRKACA antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67491-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 67491-1-Ig (same clone as 67491-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 67491-1-Ig (PRKACA antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67491-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

PRKACA Monoclonal Antibody for WB, IHC, ELISA

Cat No. 67491-1-PBS

Clone No.4G10D7

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, ELISA

Synonyms

4G10D7, cAMP-dependent protein kinase catalytic subunit alpha, EC:2.7.11.11, PKA C alpha, PKA C-alpha

---

Product Information

67491-1-PBS targets PRKACA in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26400

  Product name: Recombinant human PRKACA protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 162-351 aa of BC039846

  Sequence: DLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF

• Full Name: protein kinase, cAMP-dependent, catalytic, alpha
• Calculated Molecular Weight: 41 kDa
• Observed Molecular Weight: 38-43 kDa
• GenBank Accession Number: BC039846
• Gene Symbol: PRKACA
• Gene ID (NCBI): 5566
• RRID: AB_2882716
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P17612
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PRKACA (protein kinase cAMP-activated catalytic subunit alpha) is a gene that encodes the catalytic subunit alpha of protein kinase A (PKA), a critical enzyme in the cyclic adenosine monophosphate (cAMP) signaling pathway. Functioning as the primary effector of cAMP, this kinase regulates a vast array of cellular processes, including metabolism, gene expression, cell cycle progression, and synaptic plasticity. Under basal conditions, the catalytic subunit is held inactive by regulatory subunits; upon cAMP binding, it is released and phosphorylates a diverse range of substrate proteins on serine and threonine residues. Beyond its physiological roles, aberrant PRKACA activity, particularly gene fusions and copy number gains, is a well-established driver of specific human diseases, most notably fibrolamellar hepatocellular carcinoma (FLC), where a characteristic DNAJB1-PRKACA fusion acts as the oncogenic driver.