PRKACA Monoclonal antibody, PBS Only

• 

  WB analysis of HeLa using 67491-1-Ig (same clone as 67491-1-PBS)

  WB result of PRKACA antibody (67491-1-Ig; 1:10000; incubated at room temperature for 1.5 hours) with sh-Control and sh-PRKACA transfected HeLa cells. This data was developed using the same antibody clone with 67491-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 67491-1-Ig (same clone as 67491-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67491-1-Ig (PRKACA antibody) at dilution of 1:2300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67491-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 67491-1-Ig (same clone as 67491-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67491-1-Ig (PRKACA antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67491-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 67491-1-Ig (same clone as 67491-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67491-1-Ig (PRKACA antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67491-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 67491-1-Ig (same clone as 67491-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 67491-1-Ig (PRKACA antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67491-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 67491-1-Ig (same clone as 67491-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 67491-1-Ig (PRKACA antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67491-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

PRKACA Monoclonal Antibody for WB, IHC, ELISA

Cat No. 67491-1-PBS

Clone No.4G10D7

Host / Isotype

Mouse / IgG2a

Reactivity

Human, Mouse, Rat

Applications

WB, IHC, ELISA

Synonyms

PKA C alpha, PKACA, PRKACA

---

Product Information

67491-1-PBS targets PRKACA in WB, IHC, ELISA applications and shows reactivity with Human, Mouse, Rat samples.

• Tested Reactivity: Human, Mouse, Rat
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26400

  Product name: Recombinant human PRKACA protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 162-351 aa of BC039846

  Sequence: DLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF

• Full Name: protein kinase, cAMP-dependent, catalytic, alpha
• Calculated Molecular Weight: 41 kDa
• Observed Molecular Weight: 38-43 kDa
• GenBank Accession Number: BC039846
• Gene Symbol: PRKACA
• Gene ID (NCBI): 5566
• RRID: AB_2882716
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P17612
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PRKACA, also named as PKACA and PKA C-alpha, belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family and cAMP subfamily. It phosphorylates a large number of substrates in the cytoplasm and the nucleus.