PRKACA Monoclonal antibody

• 

  WB analysis of HeLa using 67491-1-Ig

  WB result of PRKACA antibody (67491-1-Ig; 1:10000; incubated at room temperature for 1.5 hours) with sh-Control and sh-PRKACA transfected HeLa cells.

• 

  WB analysis using 67491-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67491-1-Ig (PRKACA antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 67491-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67491-1-Ig (PRKACA antibody) at dilution of 1:2300 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human breast cancer using 67491-1-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67491-1-Ig (PRKACA antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 67491-1-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67491-1-Ig (PRKACA antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human prostate cancer using 67491-1-Ig

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 67491-1-Ig (PRKACA antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human prostate cancer using 67491-1-Ig

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 67491-1-Ig (PRKACA antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

PRKACA Monoclonal Antibody for WB, IHC, ELISA

Cat No. 67491-1-Ig

Clone No.4G10D7

Publications(7)

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, ELISA

Synonyms

4G10D7, cAMP-dependent protein kinase catalytic subunit alpha, EC:2.7.11.11, PKA C alpha, PKA C-alpha

---

Tested Applications

• Positive WB detected in: PC-3 cells, HeLa cells, LNCaP cells, HepG2 cells, Jurkat cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells, Pig liver tissue
• Positive IHC detected in: human breast cancer tissue, human prostate cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 6 publications below

Product Information

67491-1-Ig targets PRKACA in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Cited Reactivity: human, mouse
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26400

  Product name: Recombinant human PRKACA protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 162-351 aa of BC039846

  Sequence: DLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF

• Full Name: protein kinase, cAMP-dependent, catalytic, alpha
• Calculated Molecular Weight: 41 kDa
• Observed Molecular Weight: 38-43 kDa
• GenBank Accession Number: BC039846
• Gene Symbol: PRKACA
• Gene ID (NCBI): 5566
• RRID: AB_2882716
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P17612
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PRKACA (protein kinase cAMP-activated catalytic subunit alpha) is a gene that encodes the catalytic subunit alpha of protein kinase A (PKA), a critical enzyme in the cyclic adenosine monophosphate (cAMP) signaling pathway. Functioning as the primary effector of cAMP, this kinase regulates a vast array of cellular processes, including metabolism, gene expression, cell cycle progression, and synaptic plasticity. Under basal conditions, the catalytic subunit is held inactive by regulatory subunits; upon cAMP binding, it is released and phosphorylates a diverse range of substrate proteins on serine and threonine residues. Beyond its physiological roles, aberrant PRKACA activity, particularly gene fusions and copy number gains, is a well-established driver of specific human diseases, most notably fibrolamellar hepatocellular carcinoma (FLC), where a characteristic DNAJB1-PRKACA fusion acts as the oncogenic driver.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	WB	Clin Sci (Lond); Placental small extracellular vesicles from normal pregnancy and gestational diabetes increase insulin gene transcription and content in β cells.; Authors - Faheem Seedat
mouse	WB	Int Immunopharmacol; Melatonin orchestrates cAMP-PKA signaling to alleviate zearalenone-impaired the estradiol synthesis in mammal ovary.; Authors - Qiao Li
	WB	J Clin Invest; Integrated screening identifies GPR31 as a key driver and druggable target for metabolic dysfunction-associated steatohepatitis; Authors - Xiao-Jing Zhang
human	WB	Cancer Med; FGFR1 Promotes Malignant Progression in Lung Squamous Cell Carcinoma Through Activation of Wnt/β-Catenin Signaling.; Authors - Xingyuan Li
human	WB	Eur J Histochem; Overexpression of GPER1 suppressed esophageal carcinoma growth via activating cAMP pathway.; Authors - Hongmei Yin
		CNS Neurosci Ther; Transcranial iTBS Combined With Trans-Spinal iTBS Targeting PDE1A/cAMP/PKA Axis Regulates Neural Regeneration After Spinal Cord Injury; Authors - Yingxue Fu