Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

PRKACA Monoclonal antibody

PRKACA Monoclonal Antibody for WB, IHC, ELISA

Cat No. 67491-1-Ig
Clone No.4G10D7

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, ELISA

4G10D7, cAMP-dependent protein kinase catalytic subunit alpha, EC:2.7.11.11, PKA C alpha, PKA C-alpha

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inPC-3 cells, HeLa cells, LNCaP cells, HepG2 cells, Jurkat cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells, Pig liver tissue
Positive IHC detected inhuman breast cancer tissue, human prostate cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 6 publications below

Product Information

67491-1-Ig targets PRKACA in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Cited Reactivityhuman, mouse
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag26400

Product name: Recombinant human PRKACA protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 162-351 aa of BC039846

Sequence: DLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF

Predict reactive species
Full Name protein kinase, cAMP-dependent, catalytic, alpha
Calculated Molecular Weight 41 kDa
Observed Molecular Weight 38-43 kDa
GenBank Accession NumberBC039846
Gene Symbol PRKACA
Gene ID (NCBI) 5566
RRIDAB_2882716
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP17612
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PRKACA (protein kinase cAMP-activated catalytic subunit alpha) is a gene that encodes the catalytic subunit alpha of protein kinase A (PKA), a critical enzyme in the cyclic adenosine monophosphate (cAMP) signaling pathway. Functioning as the primary effector of cAMP, this kinase regulates a vast array of cellular processes, including metabolism, gene expression, cell cycle progression, and synaptic plasticity. Under basal conditions, the catalytic subunit is held inactive by regulatory subunits; upon cAMP binding, it is released and phosphorylates a diverse range of substrate proteins on serine and threonine residues. Beyond its physiological roles, aberrant PRKACA activity, particularly gene fusions and copy number gains, is a well-established driver of specific human diseases, most notably fibrolamellar hepatocellular carcinoma (FLC), where a characteristic DNAJB1-PRKACA fusion acts as the oncogenic driver.

Protocols

Product Specific Protocols
IHC protocol for PRKACA antibody 67491-1-IgDownload protocol
WB protocol for PRKACA antibody 67491-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
WB

Clin Sci (Lond)

Placental small extracellular vesicles from normal pregnancy and gestational diabetes increase insulin gene transcription and content in β cells.

Authors - Faheem Seedat
humanWB

Mediators Inflamm

Sorbitol Destroyed Intestinal Microfold Cells (M Cells) Development through Inhibition of PDE4-Mediated RANKL Expression

Authors - Li Xiang
humanWB

Cancer Med

FGFR1 Promotes Malignant Progression in Lung Squamous Cell Carcinoma Through Activation of Wnt/β-Catenin Signaling.

Authors - Xingyuan Li
mouseWB

Int Immunopharmacol

Melatonin orchestrates cAMP-PKA signaling to alleviate zearalenone-impaired the estradiol synthesis in mammal ovary.

Authors - Qiao Li
WB

J Clin Invest

Integrated screening identifies GPR31 as a key driver and druggable target for metabolic dysfunction-associated steatohepatitis

Authors - Xiao-Jing Zhang
humanWB

Eur J Histochem

Overexpression of GPER1 suppressed esophageal carcinoma growth via activating cAMP pathway.

Authors - Hongmei Yin
Loading...
||
New chat

Able

正在加载,请稍候...