PRM2 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of human testis using 83814-1-RR (same clone as 83814-1-PBS)

  human testis tissue were subjected to SDS PAGE followed by western blot with 83814-1-RR (PRM2 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83814-1-PBS in a different storage buffer formulation.

PRM2 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 83814-1-PBS

Clone No.240576B4

Host / Isotype

Rabbit / IgG

Reactivity

Human

Applications

WB, ELISA

Synonyms

Protamine-2, Basic nuclear protein HPS2, Basic nuclear protein HPS1, Basic nuclear protein HPI2, Basic nuclear protein HPI1

---

Product Information

83814-1-PBS targets PRM2 in WB, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag5952

  Product name: Recombinant human PRM2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-102 aa of BC066338

  Sequence: MVRYRVRSLSERSHEVYRQQLHGQEQGHHGQEEQGLSPEHVEVYERTHGQSHYRRRHCSRRRLHRIHRRQHRSCRRRKRRSCRHRRRHRRGCRTRKRTCRRH

• Full Name: protamine 2
• Calculated Molecular Weight: 13 kDa
• GenBank Accession Number: BC066338
• Gene Symbol: PRM2
• Gene ID (NCBI): 5620
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P04554
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.