PRM2 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of human testis using 83814-1-RR (same clone as 83814-1-PBS)

  human testis tissue were subjected to SDS PAGE followed by western blot with 83814-1-RR (PRM2 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83814-1-PBS in a different storage buffer formulation.

PRM2 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 83814-1-PBS

Clone No.240576B4

Host / Isotype

Rabbit / IgG

Reactivity

Human

Applications

WB, ELISA

Synonyms

Protamine-2, Basic nuclear protein HPS2, Basic nuclear protein HPS1, Basic nuclear protein HPI2, Basic nuclear protein HPI1

---

Product Information

83814-1-PBS targets PRM2 in WB, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag5952

  Product name: Recombinant human PRM2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-102 aa of BC066338

  Sequence: MVRYRVRSLSERSHEVYRQQLHGQEQGHHGQEEQGLSPEHVEVYERTHGQSHYRRRHCSRRRLHRIHRRQHRSCRRRKRRSCRHRRRHRRGCRTRKRTCRRH

• Full Name: protamine 2
• Calculated Molecular Weight: 13 kDa
• GenBank Accession Number: BC066338
• Gene Symbol: PRM2
• Gene ID (NCBI): 5620
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P04554
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PRM2 (Protamine-2) is the main DNA-binding protein in the sperm nucleus, consisting of a C-terminal mature PRM2 (mPRM2) domain and an N-terminal lytic PRM2 (cPRM2) domain, which is lyzed sequentially after binding to DNA. PRM2 plays an important role in spermatogenesis and development. PRM2 is specifically expressed in sperm and localized in the sperm nucleus.