Tested Applications
Positive WB detected in | human spleen tissue, human placenta tissue |
Positive IHC detected in | human spleen tissue, human tonsillitis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
27153-1-AP targets PR3/PRTN3 in WB, IHC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag25915 Product name: Recombinant human PRTN3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 89-150 aa of BC096183 Sequence: NVRTQEPTQQHFSVAQVFLNNYDAENKLNDVLLIQLSSPANLSASVATVQLPQQDQPVPHGT Predict reactive species |
Full Name | proteinase 3 |
Calculated Molecular Weight | 256 aa, 28 kDa |
Observed Molecular Weight | 28 kDa |
GenBank Accession Number | BC096183 |
Gene Symbol | PRTN3 |
Gene ID (NCBI) | 5657 |
RRID | AB_2880777 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P24158 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for PR3/PRTN3 antibody 27153-1-AP | Download protocol |
IHC protocol for PR3/PRTN3 antibody 27153-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |