Tested Applications
| Positive WB detected in | human spleen tissue, human placenta tissue |
| Positive IHC detected in | human spleen tissue, human tonsillitis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
27153-1-AP targets PR3/PRTN3 in WB, IHC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25915 Product name: Recombinant human PRTN3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 89-150 aa of BC096183 Sequence: NVRTQEPTQQHFSVAQVFLNNYDAENKLNDVLLIQLSSPANLSASVATVQLPQQDQPVPHGT Predict reactive species |
| Full Name | proteinase 3 |
| Calculated Molecular Weight | 256 aa, 28 kDa |
| Observed Molecular Weight | 28 kDa |
| GenBank Accession Number | BC096183 |
| Gene Symbol | PRTN3 |
| Gene ID (NCBI) | 5657 |
| RRID | AB_2880777 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P24158 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for PR3/PRTN3 antibody 27153-1-AP | Download protocol |
| WB protocol for PR3/PRTN3 antibody 27153-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |















