Tested Applications
Positive IF-P detected in | human tonsillitis tissue |
Recommended dilution
Application | Dilution |
---|---|
Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
CL594-67030 targets PR3/PRTN3 in IF-P applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Mouse / IgG2b |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag25915 Product name: Recombinant human PRTN3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 89-150 aa of BC096183 Sequence: NVRTQEPTQQHFSVAQVFLNNYDAENKLNDVLLIQLSSPANLSASVATVQLPQQDQPVPHGT Predict reactive species |
Full Name | proteinase 3 |
Calculated Molecular Weight | 256 aa, 28 kDa |
Observed Molecular Weight | 28 kDa |
GenBank Accession Number | BC096183 |
Gene Symbol | PRTN3 |
Gene ID (NCBI) | 5657 |
RRID | AB_2920076 |
Conjugate | CoraLite®594 Fluorescent Dye |
Excitation/Emission Maxima Wavelengths | 588 nm / 604 nm |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | P24158 |
Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Protocols
Product Specific Protocols | |
---|---|
IF protocol for CL594 PR3/PRTN3 antibody CL594-67030 | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |