PSMG3 Monoclonal antibody, PBS Only

• 

  WB analysis using 67466-1-Ig (same clone as 67466-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67466-1-Ig (PSMG3 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67466-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 67466-1-Ig (same clone as 67466-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67466-1-Ig (PSMG3 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 67466-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HL-60 using 67466-1-Ig (same clone as 67466-1-PBS)

  HL-60 cells were subjected to SDS PAGE followed by western blot with 67466-1-Ig (PSMG3 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67466-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A549 using 67466-1-Ig (same clone as 67466-1-PBS)

  A549 cells were subjected to SDS PAGE followed by western blot with 67466-1-Ig (PSMG3 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67466-1-PBS in a different storage buffer formulation.

• 

  WB analysis of K-562 using 67466-1-Ig (same clone as 67466-1-PBS)

  K-562 cells were subjected to SDS PAGE followed by western blot with 67466-1-Ig (PSMG3 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67466-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 67466-1-Ig (same clone as 67466-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67466-1-Ig (PSMG3 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67466-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 67466-1-Ig (same clone as 67466-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using PSMG3 antibody (67466-1-Ig, Clone: 2H9C3 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 67466-1-PBS in a different storage buffer formulation.

PSMG3 Monoclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 67466-1-PBS

Clone No.2H9C3

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

C7orf48, hPAC3, PAC 3, PAC3, PAC-3

---

Product Information

67466-1-PBS targets PSMG3 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8384

  Product name: Recombinant human PSMG3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-122 aa of BC004308

  Sequence: MEDTPLVISKQKTEVVCGVPTQVVCTAFSSHILVVVTQFGKMGTLVSLEPSSVASDVSKPVLTTKVLLGQDEPLIHVFAKNLVAFVSQEAGNRAVLLAVAVKDKSMEGLKALREVIRVCQVW

• Full Name: proteasome (prosome, macropain) assembly chaperone 3
• Calculated Molecular Weight: 13 kDa
• Observed Molecular Weight: 13 kDa
• GenBank Accession Number: BC004308
• Gene Symbol: PSMG3
• Gene ID (NCBI): 84262
• RRID: AB_2882695
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9BT73
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PSMG3, also named as C7orf48 and PAC3, is a chaperone protein which promotes assembly of the 20S proteasome. It may cooperate with PSMG1-PSMG2 heterodimers to orchestrate the correct assembly of proteasomes.