Product Information
67466-1-PBS targets PSMG3 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with Human samples.
Tested Reactivity | Human |
Host / Isotype | Mouse / IgG2b |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag8384 Product name: Recombinant human PSMG3 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-122 aa of BC004308 Sequence: MEDTPLVISKQKTEVVCGVPTQVVCTAFSSHILVVVTQFGKMGTLVSLEPSSVASDVSKPVLTTKVLLGQDEPLIHVFAKNLVAFVSQEAGNRAVLLAVAVKDKSMEGLKALREVIRVCQVW Predict reactive species |
Full Name | proteasome (prosome, macropain) assembly chaperone 3 |
Calculated Molecular Weight | 13 kDa |
Observed Molecular Weight | 13 kDa |
GenBank Accession Number | BC004308 |
Gene Symbol | PSMG3 |
Gene ID (NCBI) | 84262 |
RRID | AB_2882695 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | Q9BT73 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |