PSMG3 Monoclonal antibody

• 

  WB analysis using 67466-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67466-1-Ig (PSMG3 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 67466-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67466-1-Ig (PSMG3 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control.

• 

  WB analysis of K-562 using 67466-1-Ig

  K-562 cells were subjected to SDS PAGE followed by western blot with 67466-1-Ig (PSMG3 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A549 using 67466-1-Ig

  A549 cells were subjected to SDS PAGE followed by western blot with 67466-1-Ig (PSMG3 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 67466-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67466-1-Ig (PSMG3 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HL-60 using 67466-1-Ig

  HL-60 cells were subjected to SDS PAGE followed by western blot with 67466-1-Ig (PSMG3 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HeLa using 67466-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using PSMG3 antibody (67466-1-Ig, Clone: 2H9C3 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L), CL594-Phalloidin (red).

PSMG3 Monoclonal Antibody for WB, IF/ICC, ELISA

Cat No. 67466-1-Ig

Clone No.2H9C3

Publications(1)

Host / Isotype

Mouse / IgG2b

Reactivity

Human and More (1)

Applications

WB, IF/ICC, ELISA

Synonyms

C7orf48, hPAC3, PAC 3, PAC3, PSMG3

---

Tested Applications

• Positive WB detected in: LNCaP cells, Jurkat cells, K-562 cells, HL-60 cells, A549 cells, Hela cells, HEK-293 cells
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

67466-1-Ig targets PSMG3 in WB, IF/ICC, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8384

  Product name: Recombinant human PSMG3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-122 aa of BC004308

  Sequence: MEDTPLVISKQKTEVVCGVPTQVVCTAFSSHILVVVTQFGKMGTLVSLEPSSVASDVSKPVLTTKVLLGQDEPLIHVFAKNLVAFVSQEAGNRAVLLAVAVKDKSMEGLKALREVIRVCQVW

• Full Name: proteasome (prosome, macropain) assembly chaperone 3
• Calculated Molecular Weight: 13 kDa
• Observed Molecular Weight: 13 kDa
• GenBank Accession Number: BC004308
• Gene Symbol: PSMG3
• Gene ID (NCBI): 84262
• RRID: AB_2882695
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9BT73
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	bioRxiv; PI31 is a positive regulator of 20S immunoproteasome assembly; Authors - Jason Wang