Tested Applications
Positive WB detected in | LNCaP cells, Jurkat cells, K-562 cells, HL-60 cells, A549 cells, Hela cells, HEK-293 cells |
Positive IF/ICC detected in | HeLa cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:2000-1:10000 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
Product Information
67466-1-Ig targets PSMG3 in WB, IF/ICC, ELISA applications and shows reactivity with Human samples.
Tested Reactivity | Human |
Cited Reactivity | human |
Host / Isotype | Mouse / IgG2b |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag8384 Product name: Recombinant human PSMG3 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-122 aa of BC004308 Sequence: MEDTPLVISKQKTEVVCGVPTQVVCTAFSSHILVVVTQFGKMGTLVSLEPSSVASDVSKPVLTTKVLLGQDEPLIHVFAKNLVAFVSQEAGNRAVLLAVAVKDKSMEGLKALREVIRVCQVW Predict reactive species |
Full Name | proteasome (prosome, macropain) assembly chaperone 3 |
Calculated Molecular Weight | 13 kDa |
Observed Molecular Weight | 13 kDa |
GenBank Accession Number | BC004308 |
Gene Symbol | PSMG3 |
Gene ID (NCBI) | 84262 |
RRID | AB_2882695 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | Q9BT73 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for PSMG3 antibody 67466-1-Ig | Download protocol |
IF protocol for PSMG3 antibody 67466-1-Ig | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |