Tested Applications
| Positive WB detected in | LNCaP cells, Jurkat cells, K-562 cells, HL-60 cells, A549 cells, Hela cells, HEK-293 cells |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below |
Product Information
67466-1-Ig targets PSMG3 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag8384 Product name: Recombinant human PSMG3 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-122 aa of BC004308 Sequence: MEDTPLVISKQKTEVVCGVPTQVVCTAFSSHILVVVTQFGKMGTLVSLEPSSVASDVSKPVLTTKVLLGQDEPLIHVFAKNLVAFVSQEAGNRAVLLAVAVKDKSMEGLKALREVIRVCQVW Predict reactive species |
| Full Name | proteasome (prosome, macropain) assembly chaperone 3 |
| Calculated Molecular Weight | 13 kDa |
| Observed Molecular Weight | 13 kDa |
| GenBank Accession Number | BC004308 |
| Gene Symbol | PSMG3 |
| Gene ID (NCBI) | 84262 |
| RRID | AB_2882695 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q9BT73 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PSMG3, also named as C7orf48 and PAC3, is a chaperone protein which promotes assembly of the 20S proteasome. It may cooperate with PSMG1-PSMG2 heterodimers to orchestrate the correct assembly of proteasomes.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for PSMG3 antibody 67466-1-Ig | Download protocol |
| WB protocol for PSMG3 antibody 67466-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |













