PTEN Monoclonal antibody

• Home
• Products
• Primary Antibodies
• PTEN Monoclonal antibody (60300-3-Ig)

PTEN Monoclonal Antibody for WB, ELISA

Cat No. 60300-3-Ig

Clone No.4D8G9

Publications(22)

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse and More (1)

Applications

WB, IF, ELISA

Synonyms

10q23del, 4D8G9, Bannayan Zonana syndrome, BC005821, BZS

• 

  WB analysis using 60300-3-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 60300-3-Ig (PTEN antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

---

Tested Applications

• Positive WB detected in: HeLa cells, MCF-7 cells, DU 145 cells, HT-29 cells, NIH/3T3 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:5000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

60300-3-Ig targets PTEN in WB, IF, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17274

  Product name: Recombinant human PTEN protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 204-403 aa of BC005821

  Sequence: PMFSGGTCNPQFVVCQLKVKIYSSNSGPTRREDKFMYFEFPQPLPVCGDIKVEFFHKQNKMLKKDKMFHFWVNTFFIPGPEETSEKVENGSLCDQEIDSICSIERADNDKEYLVLTLTKNDLDKANKDKANRYFSPNFKVKLYFTKTVEEPSNPEASSSTSVTPDVSDNEPDHYRYSDTTDSDPENEPFDEDQHTQITK

• Full Name: phosphatase and tensin homolog
• Calculated Molecular Weight: 47 kDa
• Observed Molecular Weight: 55 kDa
• GenBank Accession Number: BC005821
• Gene Symbol: PTEN
• Gene ID (NCBI): 5728
• RRID: AB_3743213
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P60484
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PTEN (also designated MMAC1), products of tumor suppressor genes, are found deleted in most human gliomas. The PTEN genes are also mutated in many other tumors, such as brain, breast, kidney and prostate cancers. PTEN is a protein tyrosine phosphatase that may terminate the signaling transduction pathways mediated by PI 3-kinase/Akt. PTEN has an apparent molecular weight of 55 kDa.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat,mouse	WB,IF	Mol Med; Ubiquitin specific peptidase 11 knockdown slows Huntington's disease progression via regulating mitochondrial dysfunction and neuronal damage depending on PTEN-mediated AKT pathway; Authors - Bai Gao
rat	WB	Appl Biochem Biotechnol; Chemopreventive Potential of Brucine-Gold Nanoparticles (BRU-AuNPs) in DMBA-induced Mammary Cancer via Modulation of PI3K/AKT/mTOR Pathway.; Authors - Saravanan Alamelu
human	WB,IF	Mar Life Sci Technol; New activities of homoyessotoxin against lung cancer through the regulation of EGFR/PI3K/AKT pathway.; Authors - Kuilin Chen
	WB	Biochem Biophys Rep; Study on the effect of HMGB1 on immune cells isolated from SLE mice; Authors - Xin Qin
mouse, human	WB	Biochem Pharmacol; PRC1 mediates downstream PI3K-AKT activation through regulating PTEN ubiquitination degradation in TAC-induced cardiac remodeling.; Authors - Qun Tang
		Phytomedicine; Columbianadin improves M1 polarization of microglia after spinal cord injury by stabilizing PTEN and inhibiting the PI3K/AKT pathway.; Authors - Shining Xiao