PTEN Monoclonal antibody, PBS Only (Detector)

PTEN Monoclonal Antibody for WB, Cytometric bead array, Indirect ELISA
Cat No. 60300-3-PBS
Clone No.4D8G9

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse

Applications

WB, Cytometric bead array, Indirect ELISA

10q23del, 4D8G9, Bannayan Zonana syndrome, BC005821, BZS

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

60300-3-PBS targets PTEN as part of a matched antibody pair:

MP50170-1: 60300-2-PBS capture and 60300-3-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag17274

Product name: Recombinant human PTEN protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 204-403 aa of BC005821

Sequence: PMFSGGTCNPQFVVCQLKVKIYSSNSGPTRREDKFMYFEFPQPLPVCGDIKVEFFHKQNKMLKKDKMFHFWVNTFFIPGPEETSEKVENGSLCDQEIDSICSIERADNDKEYLVLTLTKNDLDKANKDKANRYFSPNFKVKLYFTKTVEEPSNPEASSSTSVTPDVSDNEPDHYRYSDTTDSDPENEPFDEDQHTQITK

Predict reactive species
Full Name phosphatase and tensin homolog
Calculated Molecular Weight 47 kDa
Observed Molecular Weight 55 kDa
GenBank Accession NumberBC005821
Gene Symbol PTEN
Gene ID (NCBI) 5728
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP60484
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

PTEN (also designated MMAC1), products of tumor suppressor genes, are found deleted in most human gliomas. The PTEN genes are also mutated in many other tumors, such as brain, breast, kidney and prostate cancers. PTEN is a protein tyrosine phosphatase that may terminate the signaling transduction pathways mediated by PI 3-kinase/Akt. PTEN has an apparent molecular weight of 55 kDa.

Loading...
||
New chat Able
正在加载,请稍候...