PTEN Monoclonal antibody

• Home
• Products
• Primary Antibodies
• PTEN Monoclonal antibody (60300-3-Ig)

• 

  WB analysis using 60300-3-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 60300-3-Ig (PTEN antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

PTEN Monoclonal Antibody for WB, ELISA

Cat No. 60300-3-Ig

Clone No.4D8G9

Publications(13)

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse and More (1)

Applications

WB, IF, ELISA

Synonyms

10q23del, 4D8G9, Bannayan Zonana syndrome, BC005821, BZS

---

Tested Applications

• Positive WB detected in: HeLa cells, MCF-7 cells, DU 145 cells, HT-29 cells, NIH/3T3 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:5000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 12 publications below
• IF: See 2 publications below

Product Information

60300-3-Ig targets PTEN in WB, IF, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17274

  Product name: Recombinant human PTEN protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 204-403 aa of BC005821

  Sequence: PMFSGGTCNPQFVVCQLKVKIYSSNSGPTRREDKFMYFEFPQPLPVCGDIKVEFFHKQNKMLKKDKMFHFWVNTFFIPGPEETSEKVENGSLCDQEIDSICSIERADNDKEYLVLTLTKNDLDKANKDKANRYFSPNFKVKLYFTKTVEEPSNPEASSSTSVTPDVSDNEPDHYRYSDTTDSDPENEPFDEDQHTQITK

• Full Name: phosphatase and tensin homolog
• Calculated Molecular Weight: 47 kDa
• Observed Molecular Weight: 55 kDa
• GenBank Accession Number: BC005821
• Gene Symbol: PTEN
• Gene ID (NCBI): 5728
• RRID: AB_3743213
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P60484
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PTEN (also designated MMAC1), products of tumor suppressor genes, are found deleted in most human gliomas. The PTEN genes are also mutated in many other tumors, such as brain, breast, kidney and prostate cancers. PTEN is a protein tyrosine phosphatase that may terminate the signaling transduction pathways mediated by PI 3-kinase/Akt. PTEN has an apparent molecular weight of 55 kDa.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	ACS Nano; Remodeling of Effector and Regulatory T Cells by Capture and Utilization of miRNAs Using Nanocomposite Hydrogel for Tumor-Specific Photothermal Immunotherapy; Authors - Li Chen
	WB	J Ethnopharmacol; IGF-1 signaling pathway activation promotes axonal regeneration and repair: a mechanism study on catalpol-induced functional recovery after ischemic stroke; Authors - Yan Liu
mouse	WB	Nat Commun; Macrophage ALDH2 drives immunotherapy resistance by silencing CXCL9 through metabolic-epigenetic crosstalk; Authors - Huiying Fang
		Asian J Androl; Inhibition of the PI3K/AKT signaling pathway blocks the oncogenic activity of TRIM26 in prostate cancer cells; Authors - Yue-Ya Zhong
rat	WB	Appl Biochem Biotechnol; Chemopreventive Potential of Brucine-Gold Nanoparticles (BRU-AuNPs) in DMBA-induced Mammary Cancer via Modulation of PI3K/AKT/mTOR Pathway.; Authors - Saravanan Alamelu
human	WB	Front Oncol; MiR-424-5p acts as an oncogene in Hep3B cells by activating the PI3K/AKT signaling pathway.; Authors - Zhixian Ding