PYK2 Monoclonal antibody

• 

  WB analysis using 67141-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67141-1-Ig (PYK2 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 67141-1-Ig

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 67141-1-Ig (PYK2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse brain using 67141-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 67141-1-Ig (PYK2 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 67141-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 67141-1-Ig (PYK2 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

PYK2 Monoclonal Antibody for WB, IHC, ELISA

Cat No. 67141-1-Ig

Clone No.2A10G5

Publications(1)

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, ELISA

Synonyms

PTK2B, 2A10G5, CADTK, CAK beta, CAKB

---

Tested Applications

• Positive WB detected in: Jurkat cells, mouse brain tissue, K-562 cells, Ramos cells, pig brain tissue
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

67141-1-Ig targets PYK2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11487

  Product name: Recombinant human PTK2B protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 646-1009 aa of BC042599

  Sequence: KPDLCPPVLYTLMTRCWDYDPSDRPRFTELVCSLSDVYQMEKDIAMEQERNARYRTPKILEPTAFQEPPPKPSRPKYRPPPQTNLLAPKLQFQVPEGLCASSPTLTSPMEYPSPVNSLHTPPLHRHNVFKRHSMREEDFIQPSSREEAQQLWEAEKVKMRQILDKQQKQMVEDYQWLRQEEKSLDPMVYMNDKSPLTPEKEVGYLEFTGPPQKPPRLGAQSIQPTANLDRTDDLVYLNVMELVRAVLELKNELCQLPPEGYVVVVKNVGLTLRKLIGSVDDLLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLAQQNAVTSLSEECKRQMLTASHTLAVDAKNLLDAVDQAKVLANLAHPPAE

• Full Name: PTK2B protein tyrosine kinase 2 beta
• Calculated Molecular Weight: 1009 aa, 116 kDa
• Observed Molecular Weight: 112-115 kDa
• GenBank Accession Number: BC042599
• Gene Symbol: PTK2B
• Gene ID (NCBI): 2185
• RRID: AB_2882440
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q14289
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Proline-rich tyrosine kinase 2 (Pyk2; also known as CAK, RAFTK and CADTK) is a cytoplasmic tyrosine kinase implicated to play a role in several intracellular signaling pathways. It is expressed in many cells and tissues and migrated as a 130 kDa band in Western Blotting analysis. The size of PYK2 is 115 kDa, and it expressed in many cells and tissues and migrated as a 130 kDa band, but several lower molecular weight bands (75 kDa, 80 kDa, and 97 kDa) were seen in Western Blotting analysis, possibly due to proteolytic degradation.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	bioRxiv; Discovery of electrophilic degraders that exploit SNAr chemistry; Authors - Zhe Zhuang