PYK2 Monoclonal antibody, PBS Only

• 

  WB analysis using 67141-1-Ig (same clone as 67141-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67141-1-Ig (PYK2 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67141-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 67141-1-Ig (same clone as 67141-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 67141-1-Ig (PYK2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67141-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 67141-1-Ig (same clone as 67141-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 67141-1-Ig (PYK2 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67141-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 67141-1-Ig (same clone as 67141-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 67141-1-Ig (PYK2 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67141-1-PBS in a different storage buffer formulation.

PYK2 Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 67141-1-PBS

Clone No.2A10G5

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, Indirect ELISA

Synonyms

PTK2B, 2A10G5, CADTK, CAK beta, CAKB

---

Product Information

67141-1-PBS targets PYK2 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11487

  Product name: Recombinant human PTK2B protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 646-1009 aa of BC042599

  Sequence: KPDLCPPVLYTLMTRCWDYDPSDRPRFTELVCSLSDVYQMEKDIAMEQERNARYRTPKILEPTAFQEPPPKPSRPKYRPPPQTNLLAPKLQFQVPEGLCASSPTLTSPMEYPSPVNSLHTPPLHRHNVFKRHSMREEDFIQPSSREEAQQLWEAEKVKMRQILDKQQKQMVEDYQWLRQEEKSLDPMVYMNDKSPLTPEKEVGYLEFTGPPQKPPRLGAQSIQPTANLDRTDDLVYLNVMELVRAVLELKNELCQLPPEGYVVVVKNVGLTLRKLIGSVDDLLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLAQQNAVTSLSEECKRQMLTASHTLAVDAKNLLDAVDQAKVLANLAHPPAE

• Full Name: PTK2B protein tyrosine kinase 2 beta
• Calculated Molecular Weight: 1009 aa, 116 kDa
• Observed Molecular Weight: 112-115 kDa
• GenBank Accession Number: BC042599
• Gene Symbol: PTK2B
• Gene ID (NCBI): 2185
• RRID: AB_2882440
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q14289
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Proline-rich tyrosine kinase 2 (Pyk2; also known as CAK, RAFTK and CADTK) is a cytoplasmic tyrosine kinase implicated to play a role in several intracellular signaling pathways. It is expressed in many cells and tissues and migrated as a 130 kDa band in Western Blotting analysis. The size of PYK2 is 115 kDa, and it expressed in many cells and tissues and migrated as a 130 kDa band, but several lower molecular weight bands (75 kDa, 80 kDa, and 97 kDa) were seen in Western Blotting analysis, possibly due to proteolytic degradation.