CoraLite® Plus 488-conjugated PTK2B Monoclonal antibody

PTK2B Monoclonal Antibody for FC (Intra)
Cat No. CL488-67141
Clone No.2A10G5

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

FC (Intra)

PYK2, 2A10G5, CADTK, CAK beta, CAKB

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inJurkat cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67141 targets PTK2B in FC (Intra) applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag11487

Product name: Recombinant human PTK2B protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 646-1009 aa of BC042599

Sequence: KPDLCPPVLYTLMTRCWDYDPSDRPRFTELVCSLSDVYQMEKDIAMEQERNARYRTPKILEPTAFQEPPPKPSRPKYRPPPQTNLLAPKLQFQVPEGLCASSPTLTSPMEYPSPVNSLHTPPLHRHNVFKRHSMREEDFIQPSSREEAQQLWEAEKVKMRQILDKQQKQMVEDYQWLRQEEKSLDPMVYMNDKSPLTPEKEVGYLEFTGPPQKPPRLGAQSIQPTANLDRTDDLVYLNVMELVRAVLELKNELCQLPPEGYVVVVKNVGLTLRKLIGSVDDLLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLAQQNAVTSLSEECKRQMLTASHTLAVDAKNLLDAVDQAKVLANLAHPPAE

Predict reactive species
Full Name PTK2B protein tyrosine kinase 2 beta
Calculated Molecular Weight 1009 aa, 116 kDa
Observed Molecular Weight 112-115 kDa
GenBank Accession NumberBC042599
Gene Symbol PTK2B
Gene ID (NCBI) 2185
RRIDAB_3084314
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ14289
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Proline-rich tyrosine kinase 2 (Pyk2; also known as CAK, RAFTK and CADTK) is a cytoplasmic tyrosine kinase implicated to play a role in several intracellular signaling pathways. It is expressed in many cells and tissues and migrated as a 130 kDa band in Western Blotting analysis. The size of PYK2 is 115 kDa, and it expressed in many cells and tissues and migrated as a 130 kDa band, but several lower molecular weight bands (75 kDa, 80 kDa, and 97 kDa) were seen in Western Blotting analysis, possibly due to proteolytic degradation.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 PTK2B antibody CL488-67141Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...