PTPN9 Monoclonal antibody, PBS Only

• 

  WB analysis using 67931-1-Ig (same clone as 67931-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67931-1-Ig (PTPN9 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67931-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A549 using 67931-1-Ig (same clone as 67931-1-PBS)

  WB result of PTPN9 antibody (67931-1-Ig; 1:10000; incubated at room temperature for 1.5 hours) with sh-Control and sh-PTPN9 transfected A549 cells. This data was developed using the same antibody clone with 67931-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 67931-1-Ig (same clone as 67931-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67931-1-Ig (PTPN9 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67931-1-PBS in a different storage buffer formulation.

• 

  WB analysis of pig pancreas using 67931-1-Ig (same clone as 67931-1-PBS)

  pig pancreas tissue were subjected to SDS PAGE followed by western blot with 67931-1-Ig (PTPN9 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67931-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U2OS using 67931-1-Ig (same clone as 67931-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed U2OS cells using PTPN9 antibody (67931-1-Ig, Clone: 1D6E4 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67931-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

PTPN9 Monoclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 67931-1-PBS

Clone No.1D6E4

Host / Isotype

Mouse / IgG1

Reactivity

Human, pig, mouse

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

MEG2, PTPase MEG2, PTPMEG2, PTPN9

---

Product Information

67931-1-PBS targets PTPN9 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with Human, pig, mouse samples.

• Tested Reactivity: Human, pig, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30615

  Product name: Recombinant human PTPN9 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 248-593 aa of BC010863

  Sequence: FQFLPQVNGHPDPFDEIILFSLPPALDWDSVHVPGPHAMTIQELVDYVNARQKQGIYEEYEDIRRENPVGTFHCSMSPGNLEKNRYGDVPCLDQTRVKLTKRSGHTQTDYINASFMDGYKQKNAYIGTQGPLENTYRDFWLMVWEQKVLVIVMTTRFEEGGRRKCGQYWPLEKDSRIRFGFLTVTNLGVENMNHYKKTTLEIHNTEERQKRQVTHFQFLSWPDYGVPSSAASLIDFLRVVRNQQSLAVSNMGARSKGQCPEPPIVVHCSAGIGRTGTFCSLDICLAQLEELGTLNVFQTVSRMRTQRAFSIQTPEQYYFCYKAILEFAEKEGMVSSGQNLLAVESQ

• Full Name: protein tyrosine phosphatase, non-receptor type 9
• Calculated Molecular Weight: 593 aa, 68 kDa
• Observed Molecular Weight: 68 kDa
• GenBank Accession Number: BC010863
• Gene Symbol: PTPN9
• Gene ID (NCBI): 5780
• RRID: AB_2918683
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P43378
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PTPN9, Tyrosine-protein phosphatase non-receptor type 9, is a member of the protein tyrosine phosphatase (PTP) family. PTPs are signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. PTPN9 is involved in the transfer of hydrophobic ligands or in functions of the Golgi apparatus (PMID: 19167335). MiR-96 inhibits PTPN9 expression and consequently promotes proliferation, migration and invasion of breast cancer cells (PMID:27857177).