PTPN9 Monoclonal antibody

• 

  WB analysis using 67931-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67931-1-Ig (PTPN9 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A549 using 67931-1-Ig

  WB result of PTPN9 antibody (67931-1-Ig; 1:10000; incubated at room temperature for 1.5 hours) with sh-Control and sh-PTPN9 transfected A549 cells.

• 

  WB analysis of pig pancreas using 67931-1-Ig

  pig pancreas tissue were subjected to SDS PAGE followed by western blot with 67931-1-Ig (PTPN9 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 67931-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67931-1-Ig (PTPN9 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of U2OS using 67931-1-Ig

  Immunofluorescent analysis of (-20°C Methanol) fixed U2OS cells using PTPN9 antibody (67931-1-Ig, Clone: 1D6E4 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L).

• Featured Product
• KD/KO Validated

PTPN9 Monoclonal Antibody for WB, IF/ICC, ELISA

Cat No. 67931-1-Ig

Clone No.1D6E4

Host / Isotype

Mouse / IgG1

Reactivity

Human, pig, mouse

Applications

WB, IF/ICC, ELISA

Synonyms

MEG2, PTPase MEG2, PTPMEG2, PTPN9

---

Tested Applications

• Positive WB detected in: MCF-7 cells, Jurkat cells, pig pancreas tissue, A549 cells, Hela cells, RAW 264.7 cells
• Positive IF/ICC detected in: U2OS cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67931-1-Ig targets PTPN9 in WB, IF/ICC, ELISA applications and shows reactivity with Human, pig, mouse samples.

• Tested Reactivity: Human, pig, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30615

  Product name: Recombinant human PTPN9 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 248-593 aa of BC010863

  Sequence: FQFLPQVNGHPDPFDEIILFSLPPALDWDSVHVPGPHAMTIQELVDYVNARQKQGIYEEYEDIRRENPVGTFHCSMSPGNLEKNRYGDVPCLDQTRVKLTKRSGHTQTDYINASFMDGYKQKNAYIGTQGPLENTYRDFWLMVWEQKVLVIVMTTRFEEGGRRKCGQYWPLEKDSRIRFGFLTVTNLGVENMNHYKKTTLEIHNTEERQKRQVTHFQFLSWPDYGVPSSAASLIDFLRVVRNQQSLAVSNMGARSKGQCPEPPIVVHCSAGIGRTGTFCSLDICLAQLEELGTLNVFQTVSRMRTQRAFSIQTPEQYYFCYKAILEFAEKEGMVSSGQNLLAVESQ

• Full Name: protein tyrosine phosphatase, non-receptor type 9
• Calculated Molecular Weight: 593 aa, 68 kDa
• Observed Molecular Weight: 68 kDa
• GenBank Accession Number: BC010863
• Gene Symbol: PTPN9
• Gene ID (NCBI): 5780
• RRID: AB_2918683
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P43378
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PTPN9, Tyrosine-protein phosphatase non-receptor type 9, is a member of the protein tyrosine phosphatase (PTP) family. PTPs are signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. PTPN9 is involved in the transfer of hydrophobic ligands or in functions of the Golgi apparatus (PMID: 19167335). MiR-96 inhibits PTPN9 expression and consequently promotes proliferation, migration and invasion of breast cancer cells (PMID:27857177).