PTPRU Polyclonal antibody

• 

  WB analysis using 23786-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 23786-1-AP (PTPRU antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of U-251 using 23786-1-AP

  Immunofluorescent analysis of (4% PFA) fixed U-251 cells using PTPRU antibody (23786-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-Phalloidin (red).

PTPRU Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 23786-1-AP

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

PTP, PCP2, PCP 2, hPTP J, GLEPP1

---

Tested Applications

• Positive WB detected in: A549 cells, MCF-7 cells, U-251 cells
• Positive IF/ICC detected in: U-251 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

23786-1-AP targets PTPRU in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20667

  Product name: Recombinant human PTPRU protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 19-146 aa of BC146655

  Sequence: ETETPAAGCTFEEASDPAVPCEYSQAQYDDFQWEQVRIHPGTRAPADLPHGSYLMVNTSQHAPGQRAHVIFQSLSENDTHCVQFSYFLYSRDGHSPGTLGVYVRVNGGPLGSAVWNMTGSHGRQWHQA

• Full Name: protein tyrosine phosphatase, receptor type, U
• Calculated Molecular Weight: 1446 aa, 162 kDa
• Observed Molecular Weight: 170 kDa
• GenBank Accession Number: BC146655
• Gene Symbol: PTPRU
• Gene ID (NCBI): 10076
• RRID: AB_3669416
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q92729
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PTPRU (protein tyrosine phosphatase, receptor type, U) is also named as PCP-2,PTP-J, PTP pi, PTP-RO and R-PTP-psi. Protein tyrosine phosphatase plays a crucial role in the regulation of signal transduction during diverse cell functions, including cell activation, proliferation, differentiation, survival, and metabolic homeostasis. PTPases are classified into two groups, membrane-spanning receptor-type (R-PTPases) and cytosolictype. The human PTPRU cDNA clone encodes a polypeptide of 1,439 amino acids and the predicted molecular mass of the PTPRU protein is 162 kDa. It has reported that SCF induced tyrosine phosphorylation of the full-length PTPRU (190 kDa) and the proteolytic forms of PTPRU (100 and 80 kD). A non-tyrosine phosphorylated 73 kDa band was detected in addition to those of 190, 90, and 80 kDa. (PMID: 10397721).

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Jelan (Verified Customer) (10-17-2025)

The antibodies we have used for western blot from protein tech are all good and this one specifically blots at its corrected spot of around 180 kda

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: Rabbit / IgG