PWP2 Polyclonal antibody

• 

  WB analysis of HeLa using 11390-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 11390-1-AP (PWP2 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HeLa using 11390-1-AP

  IP result of anti-PWP2 (IP:11390-1-AP, 4ug; Detection:11390-1-AP 1:600) with HeLa cells lysate 2400ug.

• 

  IF Staining of HepG2 using 11390-1-AP

  Immunofluorescent analysis of HepG2 cells, using PWP2 antibody 11390-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red). Blue pseudocolor = DAPI (fluorescent DNA dye).

PWP2 Polyclonal Antibody for WB, IF/ICC, IP, ELISA

Cat No. 11390-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, IP, ELISA

Synonyms

PWP2H

---

Tested Applications

• Positive WB detected in: HeLa cells
• Positive IP detected in: HeLa cells
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

11390-1-AP targets PWP2 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1936

  Product name: Recombinant human PWP2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 520-919 aa of BC014988

  Sequence: SWDKTVRLWDMFDSWRTKETLALTSDALAVTIRPDGAELAVATLNSQITFWDPENAVQTGSIEGRHDLKTGRKELDKITAKHAAKGKAFTALCYSADGHSILAGGMSKFVCIYHVREQILMKRFEISCNLSLDAMEEFLNRRKMTEFGNLALIDQDAGQEDGVAIPLPGVRKGDMSSRHFKPEIRVTSLRFSPTGRCWAATTTEGLLIYSLDTRVLFDPFELDTSVTPGRVREALRQQDFTRAILMALRLNESKLVQEALEAVPRGEIEVVTSSLPELYVEKVLEFLASSFEVSRHLEFYLLWTHKLLMLHGQKLKSRAGTLLPVIQFLQKSIQRHLDDLSKLCSWNHYNMQYALAVSKQRGTKRSLDPLGSEEEAEASEDDSLHLLGGGGRDSEEEMLA

• Full Name: PWP2 periodic tryptophan protein homolog (yeast)
• Calculated Molecular Weight: 919 aa, 102 kDa
• Observed Molecular Weight: 102 kDa
• GenBank Accession Number: BC014988
• Gene Symbol: PWP2
• Gene ID (NCBI): 5822
• RRID: AB_2284709
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15269
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The function of PWP2 remains largely unknown. Catalog#11390-1-AP is a rabbit polyclonal antibody raised against the full-length of human PWP2. The MW of this protein is 102 kDa, and this antibody specially recognises the 102 kDa protein.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Front Oncol; Derivation and Validation of a Prognostic Model for Cancer Dependency Genes Based on CRISPR-Cas9 in Gastric Adenocarcinoma.; Authors - Wenjie Zhou