PYCRL Monoclonal antibody, PBS Only

• 

  WB analysis using 68087-1-Ig (same clone as 68087-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68087-1-Ig (PYCRL antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68087-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rabbit kidney using 68087-1-Ig (same clone as 68087-1-PBS)

  rabbit kidney tissue were subjected to SDS PAGE followed by western blot with 68087-1-Ig (PYCRL antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68087-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U2OS using 68087-1-Ig (same clone as 68087-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed U2OS cells using PYCRL antibody (68087-1-Ig, Clone: 1G7A3 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). This data was developed using the same antibody clone with 68087-1-PBS in a different storage buffer formulation.

PYCRL Monoclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 68087-1-PBS

Clone No.1G7A3

Host / Isotype

Mouse / IgG1

Reactivity

human, rabbit

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

PYCR3, EC:1.5.1.2, P5C reductase 3, P5CR 3, Pyrroline-5-carboxylate reductase 3

---

Product Information

68087-1-PBS targets PYCRL in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, rabbit samples.

• Tested Reactivity: human, rabbit
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31938

  Product name: Recombinant human PYCRL protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 136-274 aa of BC007993

  Sequence: IVMARGRHVGSSETKLLQHLLEACGRCEEVPEAYVDIHTGLSGSGVAFVCAFSEALAEGAVKMGMPSSLAHRIAAQTLLGTAKMLLHEGQHPAQLRSDVCTPGGTTIYGLHALEQGGLRAATMSAVEAATCRAKELSRK

• Full Name: pyrroline-5-carboxylate reductase-like
• Calculated Molecular Weight: 274 aa, 29 kDa
• Observed Molecular Weight: 26-29 kDa
• GenBank Accession Number: BC007993
• Gene Symbol: PYCRL
• Gene ID (NCBI): 65263
• RRID: AB_2918824
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q53H96
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.