Parvalbumin Recombinant monoclonal antibody, PBS Only

• 

  IHC staining of mouse cerebellum using 85819-4-RR (same clone as 85819-4-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 85819-4-RR (PVALB antibody) at dilution of 1:8000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85819-4-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse cerebellum using 85819-4-RR (same clone as 85819-4-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 85819-4-RR (PVALB antibody) at dilution of 1:8000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85819-4-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse cerebellum using 85819-4-RR (same clone as 85819-4-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse cerebellum tissue using Parvalbumin antibody (85819-4-RR, Clone: 250158B6 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85819-4-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse cerebellum using 85819-4-RR (same clone as 85819-4-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse cerebellum tissue using Parvalbumin antibody (85819-4-RR, Clone: 250158B6 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85819-4-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 85819-4-RR

  Biolayer interferometry (BLl) kinetic assays of 85819-4-RR against Human Parvalbumin were performed. The affinity constant is 0.715 nM.

Parvalbumin Uni-rAb^® Recombinant Antibody for IHC, IF-P, Indirect ELISA

Cat No. 85819-4-PBS

Clone No.250158B6

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF-P, Indirect ELISA

Synonyms

PVALB, Parvalbumin alpha

---

Product Information

85819-4-PBS targets Parvalbumin in IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag30189

  Product name: Recombinant human PVALB protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 2-110 aa of NM_002854

  Sequence: SMTDLLNAEDIKKAVGAFSATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGFILKGFSPDARDLSAKETKMLMAAGDKDGDGKIGVDEFSTLVAES

• Full Name: parvalbumin
• Calculated Molecular Weight: 12 kDa
• GenBank Accession Number: NM_002854
• Gene Symbol: Parvalbumin
• Gene ID (NCBI): 5816
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P20472
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PVALB is a high affinity calcium ion-binding protein that is structurally and functionally similar to calmodulin and troponin C. PVALB is expressed in high levels only in fast-contracting muscles and at lower levels in brain and several endocrine tissues. It is thought to be involved in muscle relaxation. Monomeric (12 kDa) and dimeric (24 kDa) forms, as well as trimeric Parvalbumin (38 kDa), have been described in a literature (PMID: 19616851).