Pericentrin Monoclonal antibody

• 

  IF Staining of HeLa using 60919-1-Ig

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using Pericentrin antibody (60919-1-Ig, Clone: 1G6F11 ) at dilution of 1:4000 and CoraLite®594-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-3).

• 

  FC experiment of Hela using 60919-1-Ig

  1x10^6 Hela cells were intracellularly stained with 0.2 μg Pericentrin Monoclonal antibody (60919-1-Ig, Clone:1G6F11) and Multi-rAb CoraLite® Plus 647-Goat Anti-Mouse Recombinant Secondary Antibody (H+L)(RGAM005)(N/A), or 0.2 μg Mouse IgM Isotype Control (65243-1-Ig, Clone: MOPC-104E) (N/A). Cells were fixed with 4% PFA .

Pericentrin Monoclonal Antibody for IF/ICC, FC (Intra), ELISA

Cat No. 60919-1-Ig

Clone No.1G6F11

Host / Isotype

Mouse / IgM

Reactivity

human

Applications

IF/ICC, FC (Intra), ELISA

Synonyms

PCNT, Pericentrin B, Pericentrin-B

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells
• Positive FC (Intra) detected in: Hela cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:2000-1:8000
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.2 μg per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

60919-1-Ig targets Pericentrin in IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgM
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27248

  Product name: Recombinant human PCNT protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 100-200 aa of AK093923

  Sequence: MDLEQLQQKQVNDHPPEQCGMFTVSDHPPEQHGMFTVGDHPPEQRGMFTVSDHPPEQHGMFTVSDHPPEQRGMFTISDHQPEQRGMFTVSDHTPEQRGIFTI

• Full Name: pericentrin
• Calculated Molecular Weight: 378 kDa
• GenBank Accession Number: AK093923
• Gene Symbol: Pericentrin
• Gene ID (NCBI): 5116
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Caprylic acid/ammonium sulfate precipitation
• UNIPROT ID: O95613
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Pericentrin (PCNT) is a large, highly conserved centrosomal protein essential for organizing the pericentriolar material (PCM)-the matrix surrounding the centrioles that nucleates and anchors microtubules. It acts as a scaffold that recruits and positions key regulatory complexes, including γ-tubulin ring complexes (γ-TuRCs), protein kinase A (PKA) and dynein, thereby orchestrating microtubule nucleation, spindle assembly and centrosome maturation throughout the cell cycle