Use Able AI chat for product recommendations

Mouse Podoplanin Recombinant monoclonal antibody, PBS Only

Podoplanin Uni-rAb® Recombinant Antibody for IHC, Indirect ELISA

Cat No. 86107-1-PBS
Clone No.250618C11

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

IHC, Indirect ELISA

E11, Glycoprotein 38, Gp38, Ots8, OTS-8

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

86107-1-PBS targets Podoplanin in IHC, Indirect ELISA applications and shows reactivity with mouse samples.

Tested Reactivity mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg2861

Product name: Recombinant Mouse Podoplanin/PDPN protein (rFc Tag)(HPLC verified)

Source: mammalian cells-derived, V37

Tag: C-rFc

Domain: 21-133 aa of NM_010329.3

Sequence: QGGTIGVNEDDIVTPGTGDGMVPPGIEDKITTTGATGGLNESTGKAPLVPTQRERGTKPPLEELSTSATSDHDHREHESTTTVKVVTSHSVDKKTSHPNRDNAGDETQTTDKK

Predict reactive species
Full Name podoplanin
Calculated Molecular Weight18 kDa
GenBank Accession NumberNM_010329.3
Gene Symbol Pdpn
Gene ID (NCBI) 14726
RRIDAB_3744626
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ62011
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Podoplanin was identified as a glycoprotein found in the cell membranes of glomerular epithelial cells (podocyte) (PMID: 9327748). It is a lymphatic marker because the expression of podoplanin has been detected in lymphatic but not blood vascular endothelium, and is useful as the marker of tumor-associated Lymphangiogenesis. Podoplanin has a function in developing testis, most likely at the level of cell-cell interactions among pre-meiotic germ cells and immature Sertoli cells. It may be involved in cell migration and/or actin cytoskeleton organization. When expressed in keratinocytes, Podoplanin induces changes in cell morphology with transfected cells showing an elongated shape, numerous membrane protrusions, major reorganization of the actin cytoskeleton, increased motility and decreased cell adhesion. It is required for normal lung cell proliferation and alveolus formation at birth. Podoplanin induces platelet aggregation. It does not have any effect on folic acid or amino acid transport and does not function as a water channel or as a regulator of aquaporin-type water channels.

Loading...
||
New chat

Able

正在加载,请稍候...