Podoplanin Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• Podoplanin Recombinant monoclonal antibody (86107-1-RR)

• 

  IHC staining of mouse kidney using 86107-1-RR

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 86107-1-RR (Pdpn antibody) at dilution of 1:30000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 86107-1-RR

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 86107-1-RR (Pdpn antibody) at dilution of 1:30000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse skin using 86107-1-RR

  Immunohistochemical analysis of paraffin-embedded mouse skin tissue slide using 86107-1-RR (Pdpn antibody) at dilution of 1:30000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse skin using 86107-1-RR

  Immunohistochemical analysis of paraffin-embedded mouse skin tissue slide using 86107-1-RR (Pdpn antibody) at dilution of 1:30000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  Affinity of 86107-1-RR

  Biolayer interferometry (BLI) kinetic assays of 86107-1-RR against Mouse Podoplanin were performed. The affinity constant is 5.34 nM.

Podoplanin Uni-rAb^® Recombinant Antibody for IHC, ELISA

Cat No. 86107-1-RR

Clone No.250618C11

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

IHC, ELISA

Synonyms

E11, Glycoprotein 38, Gp38, Ots8, OTS-8

---

Tested Applications

• Positive IHC detected in: mouse kidney tissue, mouse skin tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:15000-1:30000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86107-1-RR targets Podoplanin in IHC, ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2861

  Product name: Recombinant Mouse Podoplanin/PDPN protein (rFc Tag)(HPLC verified)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 21-133 aa of NM_010329.3

  Sequence: QGGTIGVNEDDIVTPGTGDGMVPPGIEDKITTTGATGGLNESTGKAPLVPTQRERGTKPPLEELSTSATSDHDHREHESTTTVKVVTSHSVDKKTSHPNRDNAGDETQTTDKK

• Full Name: podoplanin
• Calculated Molecular Weight: 18 kDa
• GenBank Accession Number: NM_010329.3
• Gene Symbol: Pdpn
• Gene ID (NCBI): 14726
• RRID: AB_3744626
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q62011
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Podoplanin was identified as a glycoprotein found in the cell membranes of glomerular epithelial cells (podocyte) (PMID: 9327748). It is a lymphatic marker because the expression of podoplanin has been detected in lymphatic but not blood vascular endothelium, and is useful as the marker of tumor-associated Lymphangiogenesis. Podoplanin has a function in developing testis, most likely at the level of cell-cell interactions among pre-meiotic germ cells and immature Sertoli cells. It may be involved in cell migration and/or actin cytoskeleton organization. When expressed in keratinocytes, Podoplanin induces changes in cell morphology with transfected cells showing an elongated shape, numerous membrane protrusions, major reorganization of the actin cytoskeleton, increased motility and decreased cell adhesion. It is required for normal lung cell proliferation and alveolus formation at birth. Podoplanin induces platelet aggregation. It does not have any effect on folic acid or amino acid transport and does not function as a water channel or as a regulator of aquaporin-type water channels.