QKI Polyclonal antibody, PBS Only

• 

  WB analysis using 13169-1-AP (same clone as 13169-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 13169-1-AP (QKI antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13169-1-PBS in a different storage buffer formulation.

• 

  IP experiment of K-562 using 13169-1-AP (same clone as 13169-1-PBS)

  IP result of anti-QKI (IP:13169-1-AP, 4ug; Detection:13169-1-AP 1:400) with K-562 cells lysate 3600ug. This data was developed using the same antibody clone with 13169-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 13169-1-AP (same clone as 13169-1-PBS)

  Immunohistochemical analysis of paraffin-embedded stomach cancer slide using 13169-1-AP (QKI antibody) at dilution of 1:300 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13169-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

QKI Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 13169-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

---

Product Information

13169-1-PBS targets QKI in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3822

  Product name: Recombinant human QKI protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-341 aa of BC019917

  Sequence: MVGEMETKEKPKPTPDYLMQLMNDKKLMSSLPNFCGIFNHLERLLDEEISRVRKDMYNDTLNGSTEKRSAELPDAVGPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAILNGTYRDANIKSPALAFSLAATAQAAPRIITGPAPVLPPAALRTPTPAGPTIMPLIRQIQTAVMPNGTPHPTAAIVPPGPEAGLIYTPYEYPYTLAPATSILEYPIEPSGVLGAVATKVRRHDMRVHPYQRIVTADRAATGN

• Full Name: quaking homolog, KH domain RNA binding (mouse)
• Calculated Molecular Weight: 341 aa, 38 kDa
• Observed Molecular Weight: 38 kDa
• GenBank Accession Number: BC019917
• Gene Symbol: QKI
• Gene ID (NCBI): 9444
• RRID: AB_2173138
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96PU8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

QKI (Quaking) is RNA-binding protein that plays a central role in myelinization (PMID: 16641098). It regulates pre-mRNA splicing, mRNA export and protein translation (PMID: 16641098). It acts upstream of or within several processes, including long-chain fatty acid biosynthetic process, positive regulation of macromolecule metabolic process and vasculogenesis. QKI shuttles internal m7G-modified transcripts into stress granules and modulates mRNA metabolism. It is expressed in the frontal cortex of brain (PMID: 16342280).