Tested Applications
| Positive WB detected in | MCF-7 cells, HeLa cells, MDCK cells, mouse brain tissue, rat brain tissue |
| Positive IHC detected in | human colon tissue, human hepatocellular carcinoma Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | NIH/3T3 cells, MCF-7 cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
27094-1-AP targets RAB10 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat, canine samples.
| Tested Reactivity | human, mouse, rat, canine |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25830 Product name: Recombinant human RAB10 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 130-200 aa of BC000896 Sequence: RVVPKGKGEQIAREHGIRFFETSAKANINIEKAFLTLAEDILRKTPVKEPNSENVDISSGGGVTGWKSKCC Predict reactive species |
| Full Name | RAB10, member RAS oncogene family |
| Calculated Molecular Weight | 200 aa, 23 kDa |
| Observed Molecular Weight | 23 kDa |
| GenBank Accession Number | BC000896 |
| Gene Symbol | RAB10 |
| Gene ID (NCBI) | 10890 |
| RRID | AB_2880752 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P61026 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
RAB10 is a member of the RAB family of small GTPases, which are key regulators of vesicular trafficking. RAB proteins are cyclically controlled, requiring a GDP-GTP exchange that is facilitated by RAB guanine nucleotide exchange factors. Rab10 plays essential functional roles in development: mice are embryonic lethal when both alleles are deleted. In addition, RAB10 plays a role in maintenance and regulation of endoplasmic reticulum (ER) morphology. RAB10 function has also been linked to neuronal morphology and polarization, playing a critical role in axonal development and dendrite arborization.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for RAB10 antibody 27094-1-AP | Download protocol |
| IF protocol for RAB10 antibody 27094-1-AP | Download protocol |
| IHC protocol for RAB10 antibody 27094-1-AP | Download protocol |
| WB protocol for RAB10 antibody 27094-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The RAB10 Polyclonal antibody (Cat# 27094-1-AP) has a total of 3 citations. These appear in EMBO Journal, Biochemical and Biophysical Research Communications, and F1000Research. The associated research fields include ciliary cholesterol metabolism and hereditary Zellweger syndrome, extracellular HSPA5 regulation of neuronal process elongation, and antibody performance validation for Rab10 in western blot, immunoprecipitation, and immunofluorescence applications.
| Species | Application | Title |
|---|---|---|
EMBO J Insufficiency of ciliary cholesterol in hereditary Zellweger syndrome.
| ||
Biochem Biophys Res Commun Extracellular HSPA5 is autocrinally involved in the regulation of neuronal process elongation | ||
F1000Res A guide to selecting high-performing antibodies for Rab10 (UniProt ID: P61026) for use in western blot, immunoprecipitation, and immunofluorescence |
