Tested Applications
Positive WB detected in | mouse brain tissue, human brain tissue, NIH/3T3 cells, U-251 cells, rat brain tissue, U2OS cells |
Positive IP detected in | A549 cells, C2C12 cells |
Positive IHC detected in | human lung cancer tissue, human liver tissue, human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | C2C12 cells, NIH/3T3 cells, A549 cells |
Positive FC (Intra) detected in | C2C12 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:2000-1:8000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 12 publications below |
WB | See 17 publications below |
IHC | See 6 publications below |
IF | See 7 publications below |
IP | See 4 publications below |
Product Information
11671-1-AP targets RAB1A in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag2264 Product name: Recombinant human RAB1A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-205 aa of BC000905 Sequence: MSSMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGCC Predict reactive species |
Full Name | RAB1A, member RAS oncogene family |
Calculated Molecular Weight | 205 aa, 23 kDa |
Observed Molecular Weight | 23 kDa |
GenBank Accession Number | BC000905 |
Gene Symbol | RAB1A |
Gene ID (NCBI) | 5861 |
RRID | AB_2173437 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P62820 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Rab1A is a member of the Rab family of small GTPases with a well characterized function in the regulation of vesicle trafficking from the endoplasmic reticulum to the Golgi apparatus and within Golgi compartments. Rab1A has recently been reported an mTORC1 activator and a colorectal oncogene (Janice D. Thomas. et al. 2014. Cancer cell).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for RAB1A antibody 11671-1-AP | Download protocol |
IHC protocol for RAB1A antibody 11671-1-AP | Download protocol |
IF protocol for RAB1A antibody 11671-1-AP | Download protocol |
IP protocol for RAB1A antibody 11671-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
EMBO J Loss of C9ORF72 impairs autophagy and synergizes with polyQ Ataxin-2 to induce motor neuron dysfunction and cell death. | ||
Hum Mol Genet Progressive axonal transport and synaptic protein changes correlate with behavioral and neuropathological abnormalities in the heterozygous Q175 KI mouse model of Huntington's disease. | ||
Cancer Lett Rab1A promotes IL-4R/JAK1/STAT6-dependent metastasis and determines JAK1 inhibitor sensitivity in non-small cell lung cancer.
| ||
Mol Cell Proteomics Quantitative proteomics reveals that only a subset of the endoplasmic reticulum contributes to the phagosome. | ||
Hum Mol Genet Absence of alsin function leads to corticospinal motor neuron vulnerability via novel disease mechanisms. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Victoria (Verified Customer) (10-09-2025) | Great antibody
|
FH Laura (Verified Customer) (08-15-2025) | Antibody worked great in WB and IF. Bands and fluorescence were expected. Dilutions as per data sheet. I totally recommend.
|
FH Boyan (Verified Customer) (02-22-2024) | recognized a band around the expected MW, but this antibody gave a dirty background.
|