RAB1A Recombinant monoclonal antibody

• 

  WB analysis using 81837-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 81837-1-RR (RAB1A antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  Affinity and Kinetic Characterization of 81837-1-RR

  Biolayer interferometry (BLl) kinetic assays of 81837-1-RR against Human RAB1A were performed. The affinity constant is 17.9 nM.

RAB1A Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 81837-1-RR

Clone No.2G24

Host / Isotype

Rabbit / IgG

Reactivity

Human, mouse, rat

Applications

WB, ELISA

Synonyms

YPT1, Ras-related protein Rab-1A, Ras related protein Rab 1A, RAB1, EC:3.6.5.2

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells, mouse brain tissue, rat brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

81837-1-RR targets RAB1A in WB, ELISA applications and shows reactivity with Human, mouse, rat samples.

• Tested Reactivity: Human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag2264

  Product name: Recombinant human RAB1A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-205 aa of BC000905

  Sequence: MSSMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGCC

• Full Name: RAB1A, member RAS oncogene family
• Calculated Molecular Weight: 205 aa, 23 kDa
• Observed Molecular Weight: 23-25 kDa
• GenBank Accession Number: BC000905
• Gene Symbol: RAB1A
• Gene ID (NCBI): 5861
• RRID: AB_3086459
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P62820
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.