Tested Applications
| Positive WB detected in | HeLa cells, HepG2 cells, mouse brain tissue, rat brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
81837-1-RR targets RAB1A in WB, ELISA applications and shows reactivity with Human, mouse, rat samples.
| Tested Reactivity | Human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag2264 Product name: Recombinant human RAB1A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-205 aa of BC000905 Sequence: MSSMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGCC Predict reactive species |
| Full Name | RAB1A, member RAS oncogene family |
| Calculated Molecular Weight | 205 aa, 23 kDa |
| Observed Molecular Weight | 23-25 kDa |
| GenBank Accession Number | BC000905 |
| Gene Symbol | RAB1A |
| Gene ID (NCBI) | 5861 |
| RRID | AB_3086459 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P62820 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for RAB1A antibody 81837-1-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



