RAB1A Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 81837-1-RR (same clone as 81837-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 81837-1-RR (RAB1A antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 81837-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 81837-1-PBS

  Biolayer interferometry (BLl) kinetic assays of 81837-1-RR against Human RAB1A were performed. The affinity constant is 17.9 nM.

RAB1A Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 81837-1-PBS

Clone No.2G24

Host / Isotype

Rabbit / IgG

Reactivity

Human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

YPT1, Ras-related protein Rab-1A, Ras related protein Rab 1A, RAB1, EC:3.6.5.2

---

Product Information

81837-1-PBS targets RAB1A in WB, Indirect ELISA applications and shows reactivity with Human, mouse, rat samples.

• Tested Reactivity: Human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag2264

  Product name: Recombinant human RAB1A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-205 aa of BC000905

  Sequence: MSSMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGCC

• Full Name: RAB1A, member RAS oncogene family
• Calculated Molecular Weight: 205 aa, 23 kDa
• Observed Molecular Weight: 23-25 kDa
• GenBank Accession Number: BC000905
• Gene Symbol: RAB1A
• Gene ID (NCBI): 5861
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P62820
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.