Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

RAB27A Monoclonal antibody

RAB27A Monoclonal Antibody for WB, IHC, FC (Intra), ELISA

Cat No. 66058-1-Ig
Clone No.1C4B8

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

WB, IHC, IF, FC (Intra), ELISA

1C4B8, EC:3.6.5.2, GTP binding protein Ram, GTP-binding protein Ram, Rab 27

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite®594
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, K562, K-562 cells, Jurkat cells, HEK-293 cells, HL-60 cells, HepG2 cells
Positive IHC detected inhuman lymphoma tissue, human colon cancer tissue, human skeletal muscle tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:5000-1:20000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66058-1-Ig targets RAB27A in WB, IHC, IF, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag12382

Product name: Recombinant human RAB27A protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-221 aa of BC107680

Sequence: MSDGDYDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRASGPDGATGRGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGACGC

Predict reactive species
Full Name RAB27A, member RAS oncogene family
Calculated Molecular Weight 221 aa, 25 kDa
Observed Molecular Weight 27 kDa
GenBank Accession NumberBC107680
Gene Symbol RAB27A
Gene ID (NCBI) 5873
RRIDAB_11042596
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP51159
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Rab27A is a member of a large family of Ras-related small GTPases. The protein is membrane-bound and may be involved in protein transport and small GTPase mediated signal transduction. Recent studies suggest that Rab27A is associated with melanosomes in pigmented cells and regulates melanosome transport via its interaction with actin-based cellular motors such as myosin Va and myosin VIIa. RAB27A is also required for regulated secretion in cytotoxic T lymphocytes. Rab27A is implicated in several diseases, including Griscelli syndrome, choroideremia, and the Hermansky-Pudlak syndrome mouse model, gunmetal.

Protocols

Product Specific Protocols
FC protocol for RAB27A antibody 66058-1-IgDownload protocol
IHC protocol for RAB27A antibody 66058-1-IgDownload protocol
WB protocol for RAB27A antibody 66058-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB,IF

Sci Adv

Immune cell infiltration into brain tumor microenvironment is mediated by Rab27-regulated vascular wall integrity

Authors - Lata Adnani
mouse,humanWB,IF

Cell Metab

Arachidonic acid triggers spermidine synthase secretion from primary tumor to induce skeletal muscle weakness upon irradiation

Authors - Xiaohui Zhang
mouseWB

Stem Cell Res Ther

Empagliflozin-pretreated BMSC exosomes attenuate myocardial ischemia-reperfusion injury by enhancing atad3a/pink1-dependent mitophagy.

Authors - Yuling Jing
WB

Nat Cell Biol

Psychological stress-induced ALKBH5 deficiency promotes tumour innervation and pancreatic cancer via extracellular vesicle transfer of RNA

Authors - Ziming Chen
Loading...
||
New chat

Able

正在加载,请稍候...