• Featured Product
  • KD/KO Validated

RAB27B Monoclonal antibody

RAB27B Monoclonal Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA
Cat No. 66944-1-Ig
Clone No.2B9G9

Host / Isotype

Mouse / IgG2a

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

C25KG, 2B9G9, EC:3.6.5.2, Ras related protein Rab 27B, Ras-related protein Rab-27B

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, human peripheral blood platelets, MCF-7 cells, HeLa cells, U-87 MG cells
Positive IHC detected inhuman lung cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inA431 cells
Positive FC (Intra) detected inA431 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66944-1-Ig targets RAB27B in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag18756

Product name: Recombinant human RAB27B protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-218 aa of BC027474

Sequence: MTDGDYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYNAQGPNGSSGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARELADKYGIPYFETSAATGQNVEKAVETLLDLIMKRMEQCVEKTQIPDTVNGGNSGNLDGEKPPEKKCIC

Predict reactive species
Full Name RAB27B, member RAS oncogene family
Calculated Molecular Weight 218 aa, 25 kDa
Observed Molecular Weight 25 kDa
GenBank Accession NumberBC027474
Gene Symbol RAB27B
Gene ID (NCBI) 5874
RRIDAB_2882268
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO00194
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The Rab27 GTPase subfamily consists of two closely related homologs, Rab27a and Rab27b. Northern blot analysis revealed that Rab27b is expressed significantly only in testis, in which the predominant transcript was 1.4 kb in size. An 8-kb mRNA of unknown origin was detected in many tissues. Rab27b is associated with tubulovesicle membranes in the parietal cell and Rab27b may play a role in stimulation-associated membrane recruitment and gastric acid secretion. Rab27b is recently reported as a marker for breast cancer progression. It regulates invasive growth and metastasis in ER-positive breast cancer cell lines, and increased expression is associated with poor prognosis in humans.

Protocols

Product Specific Protocols
IF protocol for RAB27B antibody 66944-1-IgDownload protocol
IHC protocol for RAB27B antibody 66944-1-IgDownload protocol
WB protocol for RAB27B antibody 66944-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle

Mol Cell

An Epstein-Barr virus protein interaction map reveals NLRP3 inflammasome evasion via MAVS UFMylation

Authors - Stephanie Pei Tung Yiu
humanWB,IF

J Biol Chem

The GTPase Rab27b regulates the release, autophagic clearance, and toxicity of α-synuclein.

Authors - Rachel Underwood
  • KD Validated
mouseIF

FEBS Open Bio

Rab44 isoforms similarly promote lysosomal exocytosis, but exhibit differential localization in mast cells.

Authors - Tomoko Kadowaki
humanWB

Am J Reprod Immunol

Rab27b promotes endometriosis by enhancing invasiveness of ESCs and promoting angiogenesis

Authors - Jing Shan
mouseIF

Front Cell Infect Microbiol

Uropathogenic Escherichia coli infection: innate immune disorder, bladder damage, and Tailin Fang II

Authors - Zong-Ping Li
Loading...
||
New chat Able
正在加载,请稍候...