Tested Applications
| Positive WB detected in | MCF-7 cells, HEK-293 cells, human brain tissue, Jurkat cells, HepG2 cells, L02 cells, human placenta tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66654-1-Ig targets RAB43 in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26911 Product name: Recombinant human RAB43 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 91-212 aa of BC062319 Sequence: ANGAILAYDITKRSSFLSVPHWIEDVRKYAGSNIVQLLIGNKSDLSELREVSLAEAQSLAEHYDILCAIETSAKDSSNVEEAFLRVATELIMRHGGPLFSEKSPDHIQLNSKDIGEGWGCGC Predict reactive species |
| Full Name | RAB43, member RAS oncogene family |
| Calculated Molecular Weight | 212 aa, 23 kDa |
| Observed Molecular Weight | 23 kDa |
| GenBank Accession Number | BC062319 |
| Gene Symbol | RAB43 |
| Gene ID (NCBI) | 339122 |
| RRID | AB_2882011 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q86YS6 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Ras-related GTP-binding protein 43 (RAB43) is a member of the Ras superfamily. RAB43 is mainly located in endoplasmic reticulum and Golgi, and plays a role as a key regulator of vesicle movement, signal transduction and tethering membrane events in membrane trafficking.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for RAB43 antibody 66654-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The RAB43 Monoclonal antibody (3B2A8), catalog number 66654-1-Ig, has 1 total citation. It appears in Journal of Cell Science (2023), in a study investigating the role of ARF6 in targeting palmitoylated proteins from the Golgi to the plasma membrane. The associated research field is membrane trafficking and cell biology, with the antibody applied in Western blot (WB) for both human and mouse samples.
| Species | Application | Title |
|---|---|---|
J Cell Sci ARF6 plays a general role in targeting palmitoylated proteins from the Golgi to the plasma membrane |
Reviews
What customers say
All three reviews are for Western Blot at a 1:2000 dilution. Two reviewers (RKO and U2OS cells) gave 5 stars, praising the antibody's specificity for human Rab43 with clear single-band detection. One reviewer (HEK293T) gave 3 stars, noting that multiple bands were observed rather than a single clean band. Overall, the antibody performs well for Rab43 detection in most cell lines, though some users may encounter additional non-specific bands depending on the sample.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Aleksandr (Verified Customer) (07-19-2025) | Antibody recognise a specific band of human Rab43. Overnight incubation at 4C
 |
Tsimafei (Verified Customer) (11-19-2024) | Great antibody for Rab43 detection
 |
Moritz (Verified Customer) (09-12-2024) | Several bands were observable in WB. HEK293T Wt lysate.
 |
