Use Able AI chat for product recommendations

RAB43 Monoclonal antibody

RAB43 Monoclonal Antibody for WB, ELISA

Cat No. 66654-1-Ig
Clone No. 3B2A8
Publications (1)
Reviews (3)
Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human and More (1)

Applications

WB, ELISA

ISY1, RAB11B, RAB41, Ras related protein Rab 41, Ras related protein Rab 43

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for RAB43 in ?

Tested Applications

Positive WB detected inMCF-7 cells, HEK-293 cells, human brain tissue, Jurkat cells, HepG2 cells, L02 cells, human placenta tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66654-1-Ig targets RAB43 in WB, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag26911

Product name: Recombinant human RAB43 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 91-212 aa of BC062319

Sequence: ANGAILAYDITKRSSFLSVPHWIEDVRKYAGSNIVQLLIGNKSDLSELREVSLAEAQSLAEHYDILCAIETSAKDSSNVEEAFLRVATELIMRHGGPLFSEKSPDHIQLNSKDIGEGWGCGC

Predict reactive species
Full Name RAB43, member RAS oncogene family
Calculated Molecular Weight 212 aa, 23 kDa
Observed Molecular Weight 23 kDa
GenBank Accession NumberBC062319
Gene Symbol RAB43
Gene ID (NCBI) 339122
RRIDAB_2882011
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ86YS6
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Ras-related GTP-binding protein 43 (RAB43) is a member of the Ras superfamily. RAB43 is mainly located in endoplasmic reticulum and Golgi, and plays a role as a key regulator of vesicle movement, signal transduction and tethering membrane events in membrane trafficking.

Protocols

Product Specific Protocols
WB protocol for RAB43 antibody 66654-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The RAB43 Monoclonal antibody (3B2A8), catalog number 66654-1-Ig, has a total of 1 citation. The citation appears in the Journal of Cell Science (2023), in a study investigating ARF6's role in targeting palmitoylated proteins from the Golgi to the plasma membrane. The research field is cell biology, specifically membrane trafficking and vesicle transport. The antibody was used for Western blot (WB) with human and mouse samples.

SpeciesApplicationTitle
mouse,humanWB

J Cell Sci

ARF6 plays a general role in targeting palmitoylated proteins from the Golgi to the plasma membrane

Authors - Juan Wang

Reviews

    4.3 out of 5
Add a review

3 verified customer reviews

What customers say

All three reviews are for Western Blot at a 1:2000 dilution. Two users (5 stars) reported strong, specific Rab43 detection in RKO and U2OS cell lines, with one noting overnight 4°C incubation worked well. One user (3 stars) observed multiple bands when testing HEK293T wild-type lysate, suggesting slightly reduced specificity in that context. Overall, the antibody is well-received for Rab43 detection by WB, though results may vary by cell line.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Aleksandr (Verified Customer) (07-19-2025)

Antibody recognise a specific band of human Rab43. Overnight incubation at 4C

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: RKO
RAB43 Antibody Western Blot validation (1:2000 dilution) in RKO (Cat no:66654-1-Ig)

Tsimafei (Verified Customer) (11-19-2024)

Great antibody for Rab43 detection

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: U2OS
RAB43 Antibody Western Blot validation (1:2000 dilution) in U2OS (Cat no:66654-1-Ig)

Moritz (Verified Customer) (09-12-2024)

Several bands were observable in WB. HEK293T Wt lysate.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: HEK293T
RAB43 Antibody Western Blot validation (1:2000 dilution) in HEK293T (Cat no:66654-1-Ig)
Loading...
||
New chat

Able™

正在加载,请稍候...