Tested Applications
Positive WB detected in | MCF-7 cells, HEK-293 cells, human brain tissue, Jurkat cells, HepG2 cells, L02 cells, human placenta tissue |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:2000-1:10000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
Product Information
66654-1-Ig targets RAB43 in WB, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human, mouse |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag26911 Product name: Recombinant human RAB43 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 91-212 aa of BC062319 Sequence: ANGAILAYDITKRSSFLSVPHWIEDVRKYAGSNIVQLLIGNKSDLSELREVSLAEAQSLAEHYDILCAIETSAKDSSNVEEAFLRVATELIMRHGGPLFSEKSPDHIQLNSKDIGEGWGCGC Predict reactive species |
Full Name | RAB43, member RAS oncogene family |
Calculated Molecular Weight | 212 aa, 23 kDa |
Observed Molecular Weight | 23 kDa |
GenBank Accession Number | BC062319 |
Gene Symbol | RAB43 |
Gene ID (NCBI) | 339122 |
RRID | AB_2882011 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein G purification |
UNIPROT ID | Q86YS6 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Ras-related GTP-binding protein 43 (RAB43) is a member of the Ras superfamily. RAB43 is mainly located in endoplasmic reticulum and Golgi, and plays a role as a key regulator of vesicle movement, signal transduction and tethering membrane events in membrane trafficking.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for RAB43 antibody 66654-1-Ig | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Aleksandr (Verified Customer) (07-19-2025) | Antibody recognise a specific band of human Rab43. Overnight incubation at 4C
![]() |
FH Tsimafei (Verified Customer) (11-19-2024) | Great antibody for Rab43 detection
![]() |
FH Moritz (Verified Customer) (09-12-2024) | Several bands were observable in WB. HEK293T Wt lysate.
![]() |