Product Information
66654-1-PBS targets RAB43 in WB, Indirect ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag26911 Product name: Recombinant human RAB43 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 91-212 aa of BC062319 Sequence: ANGAILAYDITKRSSFLSVPHWIEDVRKYAGSNIVQLLIGNKSDLSELREVSLAEAQSLAEHYDILCAIETSAKDSSNVEEAFLRVATELIMRHGGPLFSEKSPDHIQLNSKDIGEGWGCGC Predict reactive species |
Full Name | RAB43, member RAS oncogene family |
Calculated Molecular Weight | 212 aa, 23 kDa |
Observed Molecular Weight | 23 kDa |
GenBank Accession Number | BC062319 |
Gene Symbol | RAB43 |
Gene ID (NCBI) | 339122 |
RRID | AB_2882011 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | Q86YS6 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |
Background Information
Ras-related GTP-binding protein 43 (RAB43) is a member of the Ras superfamily. RAB43 is mainly located in endoplasmic reticulum and Golgi, and plays a role as a key regulator of vesicle movement, signal transduction and tethering membrane events in membrane trafficking.