RAB43 Monoclonal antibody, PBS Only

• 

  WB analysis of human brain using 66654-1-Ig (same clone as 66654-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 66654-1-Ig (RAB43 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66654-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 66654-1-Ig (same clone as 66654-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66654-1-Ig (RAB43 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66654-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 66654-1-Ig (same clone as 66654-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 66654-1-Ig (RAB43 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66654-1-PBS in a different storage buffer formulation.

RAB43 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 66654-1-PBS

Clone No.3B2A8

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

ISY1, RAB11B, RAB41, Ras related protein Rab 41, Ras related protein Rab 43

---

Product Information

66654-1-PBS targets RAB43 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26911

  Product name: Recombinant human RAB43 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 91-212 aa of BC062319

  Sequence: ANGAILAYDITKRSSFLSVPHWIEDVRKYAGSNIVQLLIGNKSDLSELREVSLAEAQSLAEHYDILCAIETSAKDSSNVEEAFLRVATELIMRHGGPLFSEKSPDHIQLNSKDIGEGWGCGC

• Full Name: RAB43, member RAS oncogene family
• Calculated Molecular Weight: 212 aa, 23 kDa
• Observed Molecular Weight: 23 kDa
• GenBank Accession Number: BC062319
• Gene Symbol: RAB43
• Gene ID (NCBI): 339122
• RRID: AB_2882011
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q86YS6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Ras-related GTP-binding protein 43 (RAB43) is a member of the Ras superfamily. RAB43 is mainly located in endoplasmic reticulum and Golgi, and plays a role as a key regulator of vesicle movement, signal transduction and tethering membrane events in membrane trafficking.