Tested Applications
Positive WB detected in | mouse lung tissue, Jurkat cells, HeLa cells, HepG2 cells, NIH/3T3 cells, HEK-293 cells |
Positive IHC detected in | human stomach tissue, human colon tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HeLa cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 5 publications below |
IHC | See 1 publications below |
Product Information
27403-1-AP targets RAB5B in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag26584 Product name: Recombinant human RAB5B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 132-215 aa of BC032740 Sequence: GNKADLANKRMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKKLPKSEPQNLGGAAGRSRGVDLHEQSQQNKSQCCSN Predict reactive species |
Full Name | RAB5B, member RAS oncogene family |
Calculated Molecular Weight | 215 aa, 24 kDa |
Observed Molecular Weight | 27 kDa |
GenBank Accession Number | BC032740 |
Gene Symbol | RAB5B |
Gene ID (NCBI) | 5869 |
RRID | AB_2880862 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P61020 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
RAB5B (Ras-related protein Rab-5B) belongs to the Rab family. Rab5 is specifically localized to the early compartment and regulates endocytosis (PMID:1516130, PMID:9087439). There are three isoforms of Rab5 namely, Rab5a, Rab5b, and Rab5c present in EE of mammalian cells (PMID:7789520). Recently, we have shown that Rab5a regulates fluid-phase endocytosis whereas receptor-mediated endocytosis is regulated by Rab5b in Leishmania (PMID:27226564).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for RAB5B antibody 27403-1-AP | Download protocol |
IHC protocol for RAB5B antibody 27403-1-AP | Download protocol |
IF protocol for RAB5B antibody 27403-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
bioRxiv The Sde Phosphoribosyl-Linked Ubiquitin Transferases protect the Legionella pneumophila vacuole from degradation by the host
| ||
Proc Natl Acad Sci U S A The Sde phosphoribosyl-linked ubiquitin transferases protect the Legionella pneumophila vacuole from degradation by the host | ||
Mol Hum Reprod Hsa_circRNA_BECN1 acts as a ceRNA to promote polycystic ovary syndrome progression by sponging the miR-619-5p/Rab5b axis | ||
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Xin (Verified Customer) (04-15-2022) | It is ok to detect endogenous Rab5B, although the signal is a little weak.
![]() |