RAB5B Polyclonal antibody

• 

  WB analysis of HeLa using 27403-1-AP

  WB result of RAB5B antibody (27403-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-RAB5B transfected HeLa cells.

• 

  WB analysis of mouse lung using 27403-1-AP

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 27403-1-AP (RAB5B antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 27403-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 27403-1-AP (RAB5B antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 27403-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 27403-1-AP (RAB5B antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 27403-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 27403-1-AP (RAB5B antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of NIH/3T3 using 27403-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 27403-1-AP (RAB5B antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 27403-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 27403-1-AP (RAB5B antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human colon using 27403-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 27403-1-AP (RAB5B antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Sodium Citrate buffer (pH 6.0).

• 

  IHC staining of human stomach using 27403-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 27403-1-AP (RAB5B antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 27403-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using RAB5B antibody (27403-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• Featured Product
• KD/KO Validated

RAB5B Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 27403-1-AP

Publications(5)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

EC:3.6.5.2, Ras related protein Rab 5B, Ras-related protein Rab-5B

---

Tested Applications

• Positive WB detected in: mouse lung tissue, Jurkat cells, HeLa cells, HepG2 cells, NIH/3T3 cells, HEK-293 cells
• Positive IHC detected in: human stomach tissue, human colon tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 5 publications below
• IHC: See 1 publications below

Product Information

27403-1-AP targets RAB5B in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26584

  Product name: Recombinant human RAB5B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 132-215 aa of BC032740

  Sequence: GNKADLANKRMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKKLPKSEPQNLGGAAGRSRGVDLHEQSQQNKSQCCSN

• Full Name: RAB5B, member RAS oncogene family
• Calculated Molecular Weight: 215 aa, 24 kDa
• Observed Molecular Weight: 27 kDa
• GenBank Accession Number: BC032740
• Gene Symbol: RAB5B
• Gene ID (NCBI): 5869
• RRID: AB_2880862
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P61020
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RAB5B (Ras-related protein Rab-5B) belongs to the Rab family. Rab5 is specifically localized to the early compartment and regulates endocytosis (PMID:1516130, PMID:9087439). There are three isoforms of Rab5 namely, Rab5a, Rab5b, and Rab5c present in EE of mammalian cells (PMID:7789520). Recently, we have shown that Rab5a regulates fluid-phase endocytosis whereas receptor-mediated endocytosis is regulated by Rab5b in Leishmania (PMID:27226564).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	bioRxiv; The Sde Phosphoribosyl-Linked Ubiquitin Transferases protect the Legionella pneumophila vacuole from degradation by the host; Authors - Seongok Kim ; KD Validated
mouse	WB	Proc Natl Acad Sci U S A; The Sde phosphoribosyl-linked ubiquitin transferases protect the Legionella pneumophila vacuole from degradation by the host; Authors - Seongok Kim
mouse,human	WB,IHC	Mol Hum Reprod; Hsa_circRNA_BECN1 acts as a ceRNA to promote polycystic ovary syndrome progression by sponging the miR-619-5p/Rab5b axis; Authors - Hairui Fan
human	WB	Mol Metab; Tetraspanin7 in Adipose Tissue Remodeling and Its Impact on Metabolic Health; Authors - Shino Nemoto
mouse	WB	Development; A crucial role for Arf6 in the response of commissural axons to Slit.; Authors - Mariko Kinoshita-Kawada

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Xin (Verified Customer) (04-15-2022)

It is ok to detect endogenous Rab5B, although the signal is a little weak.

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: mouse cortex lysate

RAB5B Antibody Western Blot validation (1:1000 dilution) in mouse cortex lysate (Cat no:27403-1-AP)