CoraLite® Plus 488-conjugated RAB5B Polyclonal antibody

• 

  IF Staining of NIH/3T3 using CL488-27403

  Immunofluorescent analysis of (-20°C Ethanol) fixed NIH/3T3 cells using CoraLite® Plus 488 RAB5B antibody (CL488-27403) at dilution of 1:200.

• 

  FC experiment of NIH/3T3 using CL488-27403

  1x10^6 NIH/3T3 cells were intracellularly stained with 0.4 ug Coralite® Plus 488 Rab5b Polyclonal Antibody (CL488-27403)(red), or 0.4 ug CoraLite® Plus 488-conjugated Rabbit IgG control Rabbit PolyAb (CL488-30000) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

• Featured Product
• KD/KO Validated

RAB5B Polyclonal Antibody for IF/ICC, FC (Intra)

Cat No. CL488-27403

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC, FC (Intra)

Synonyms

EC:3.6.5.2, Ras related protein Rab 5B, Ras-related protein Rab-5B

---

Tested Applications

• Positive IF/ICC detected in: NIH/3T3 cells
• Positive FC (Intra) detected in: NIH/3T3 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-27403 targets RAB5B in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26584

  Product name: Recombinant human RAB5B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 132-215 aa of BC032740

  Sequence: GNKADLANKRMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKKLPKSEPQNLGGAAGRSRGVDLHEQSQQNKSQCCSN

• Full Name: RAB5B, member RAS oncogene family
• Calculated Molecular Weight: 215 aa, 24 kDa
• Observed Molecular Weight: 27 kDa
• GenBank Accession Number: BC032740
• Gene Symbol: RAB5B
• Gene ID (NCBI): 5869
• RRID: AB_3672811
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P61020
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

RAB5B (Ras-related protein Rab-5B) belongs to the Rab family. Rab5 is specifically localized to the early compartment and regulates endocytosis (PMID:1516130, PMID:9087439). There are three isoforms of Rab5 namely, Rab5a, Rab5b, and Rab5c present in EE of mammalian cells (PMID:7789520). Recently, we have shown that Rab5a regulates fluid-phase endocytosis whereas receptor-mediated endocytosis is regulated by Rab5b in Leishmania (PMID:27226564).