Tested Applications
Positive IF/ICC detected in | NIH/3T3 cells |
Positive FC (Intra) detected in | NIH/3T3 cells |
Recommended dilution
Application | Dilution |
---|---|
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
CL488-27403 targets RAB5B in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag26584 Product name: Recombinant human RAB5B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 132-215 aa of BC032740 Sequence: GNKADLANKRMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKKLPKSEPQNLGGAAGRSRGVDLHEQSQQNKSQCCSN Predict reactive species |
Full Name | RAB5B, member RAS oncogene family |
Calculated Molecular Weight | 215 aa, 24 kDa |
Observed Molecular Weight | 27 kDa |
GenBank Accession Number | BC032740 |
Gene Symbol | RAB5B |
Gene ID (NCBI) | 5869 |
RRID | AB_3672811 |
Conjugate | CoraLite® Plus 488 Fluorescent Dye |
Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P61020 |
Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
RAB5B (Ras-related protein Rab-5B) belongs to the Rab family. Rab5 is specifically localized to the early compartment and regulates endocytosis (PMID:1516130, PMID:9087439). There are three isoforms of Rab5 namely, Rab5a, Rab5b, and Rab5c present in EE of mammalian cells (PMID:7789520). Recently, we have shown that Rab5a regulates fluid-phase endocytosis whereas receptor-mediated endocytosis is regulated by Rab5b in Leishmania (PMID:27226564).
Protocols
Product Specific Protocols | |
---|---|
IF protocol for CL Plus 488 RAB5B antibody CL488-27403 | Download protocol |
FC protocol for CL Plus 488 RAB5B antibody CL488-27403 | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |