Tested Applications
Positive WB detected in | HepG2 cells, DC2.4 cells, HEK-293 cells |
Positive IHC detected in | human prostate cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HEK-293 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:6000 |
Immunohistochemistry (IHC) | IHC : 1:150-1:600 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 2 publications below |
WB | See 15 publications below |
IF | See 1 publications below |
Product Information
66592-1-Ig targets RAF1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | human, mouse |
Host / Isotype | Mouse / IgG2a |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag25423 Product name: Recombinant human RAF1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-59 aa of BC018119 Sequence: MEHIQGAWKTISNGFGFKDAVFDGSSCISPTIVQQFGYQRRASDDGKLTDPSKTSNTIR Predict reactive species |
Full Name | v-raf-1 murine leukemia viral oncogene homolog 1 |
Calculated Molecular Weight | 648 aa, 73 kDa |
Observed Molecular Weight | 70-75 kDa |
GenBank Accession Number | BC018119 |
Gene Symbol | RAF1 |
Gene ID (NCBI) | 5894 |
RRID | AB_2881952 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | P04049 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Raf-1 proto-oncogene, serine/threonine kinase(RAF1), is a MAP kinase kinase kinase (MAP3K), which functions downstream of the Ras family of membrane associated GTPases to which it binds directly. RAF1 has two isoforms with MW of 73, 75 kDa. RAF1 plays an important role in the control of gene expression involved in the cell division cycle, apoptosis, cell differentiation and cell migration.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for RAF1 antibody 66592-1-Ig | Download protocol |
IHC protocol for RAF1 antibody 66592-1-Ig | Download protocol |
IF protocol for RAF1 antibody 66592-1-Ig | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Front Immunol NMB promotes the progression of colorectal cancer by regulating the NF-κB/P65 signaling pathway | ||
World J Gastroenterol TATA-box-binding protein-associated factor 15 is a novel biomarker that promotes cell proliferation and migration in gastrointestinal stromal tumor | ||
Cancer Cell Int 4,5-Dimethoxycanthin-6-one is a novel LSD1 inhibitor that inhibits proliferation of glioblastoma cells and induces apoptosis and pyroptosis. | ||
World J Gastrointest Oncol Lnc524369 promotes hepatocellular carcinoma progression and predicts poor survival by activating YWHAZ-RAF1 signaling. | ||
Curr Med Sci Huai Qi Huang-induced Apoptosis via Down-regulating PRKCH and Inhibiting RAF/MEK/ERK Pathway in Ph+ Leukemia Cells. | ||
J Biomed Res RAF1 in AgRP neurons involved in the regulation of energy metabolism via the MAPK signaling pathway
|