Tested Applications
| Positive IF/ICC detected in | HEK-293 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL594-66592 targets RAF1 in IF/ICC applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25423 Product name: Recombinant human RAF1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-59 aa of BC018119 Sequence: MEHIQGAWKTISNGFGFKDAVFDGSSCISPTIVQQFGYQRRASDDGKLTDPSKTSNTIR Predict reactive species |
| Full Name | v-raf-1 murine leukemia viral oncogene homolog 1 |
| Calculated Molecular Weight | 648 aa, 73 kDa |
| Observed Molecular Weight | 70-75 kDa |
| GenBank Accession Number | BC018119 |
| Gene Symbol | RAF1 |
| Gene ID (NCBI) | 5894 |
| RRID | AB_2920013 |
| Conjugate | CoraLite®594 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 588 nm / 604 nm |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P04049 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Raf-1 proto-oncogene, serine/threonine kinase(RAF1), is a MAP kinase kinase kinase (MAP3K), which functions downstream of the Ras family of membrane associated GTPases to which it binds directly. RAF1 has two isoforms with MW of 73, 75 kDa. RAF1 plays an important role in the control of gene expression involved in the cell division cycle, apoptosis, cell differentiation and cell migration.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CL594 RAF1 antibody CL594-66592 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

