Tested Applications
| Positive WB detected in | COLO 320 cells, HeLa cells, U2OS cells, HUVEC cells, NCCIT cells, human spleen tissue, DC2.4 cells, JAR cells, RAW 264.7 cells |
| Positive IF/ICC detected in | MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66610-1-Ig targets TNFSF11/RANKL in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag19975 Product name: Recombinant human RANKL protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 76-317 aa of BC074890 Sequence: PNRISEDGTHCIYRILRLHENADFQDTTLESQDTKLIPDSCRRIKQAFQGAVQKELQHIVGSQHIRAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID Predict reactive species |
| Full Name | tumor necrosis factor (ligand) superfamily, member 11 |
| Calculated Molecular Weight | 317 aa, 35 kDa |
| Observed Molecular Weight | 35-38 kDa |
| GenBank Accession Number | BC074890 |
| Gene Symbol | RANKL |
| Gene ID (NCBI) | 8600 |
| RRID | AB_2881970 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | O14788 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TNFSF11 also known as RANKL, is a member of the tumor necrosis factor (TNF) cytokine family which is a ligand for osteoprotegerin and functions as a key factor for osteoclast differentiation and activation. RANKL is a polypeptide of 217 amino acids that exerts its biological activity both in a transmembrane form of about 40-45 kDa and in soluble one of 31 kDa (PMID: 15308315). The membrane-bound RANKL (mRANKL) is cleaved into a sRANKL by the metalloprotease-disintegrin TNF-alpha convertase (TACE) or a related metalloprotease (MP). RANKL induces osteoclast formation through its receptor, RANK, which transduces signals by recruiting adaptor molecules, such as the TNF receptor-associated factor (TRAF) family of proteins. RANKL was shown to be a dentritic cell survival factor and is involved in the regulation of T cell-dependent immune response. T cell activation was reported to induce expression of this gene and lead to an increase of osteoclastogenesis and bone loss. RANKL was shown to activate antiapoptotic kinase AKT/PKB through a signaling complex involving SRC kinase and tumor necrosis factor receptor-associated factor (TRAF) 6, which indicated this protein may have a role in the regulation of cell apoptosis.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for TNFSF11/RANKL antibody 66610-1-Ig | Download protocol |
| WB protocol for TNFSF11/RANKL antibody 66610-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The TNFSF11/RANKL Monoclonal antibody (Cat# 66610-1-Ig) has 34 citations. These appear across journals including Cell Metabolism, Cell Reports Medicine, Journal of Controlled Release, Cell Death & Disease, Advanced Healthcare Materials, Journal of Orthopaedic Translation, Biomedical Pharmacotherapy, Frontiers in Immunology, Science Reports, Cell Signaling, FASEB Journal, Bone, Arthritis & Rheumatology, and others. Research fields center on bone biology—osteoporosis, bone remodeling, osteoclastogenesis, and periodontitis—alongside gut microbiota–bone crosstalk, inflammation, and cancer (colorectal, prostate, myeloma). Applications span WB, IHC, and IF.
| Species | Application | Title |
|---|---|---|
Cell Metab Maltol induces diabetic fragility fractures by disrupting the balance of bone remodeling. | ||
Cell Metab Gut microbial alterations in arginine metabolism determine bone mechanical adaptation | ||
Cell Rep Med Therapeutic avenues in bone repair: Harnessing an anabolic osteopeptide, PEPITEM, to boost bone growth and prevent bone loss | ||
J Control Release Taurine-loaded covalent organic frameworks for alleviating post-radiation bone regeneration disorder. | ||
Cell Death Dis RANK promotes colorectal cancer migration and invasion by activating the Ca2+-calcineurin/NFATC1-ACP5 axis. | ||
Adv Healthc Mater Structured Polymers Enable the Sustained Delivery of Glucocorticoids within the Intra-Articular Space |
