Product Information
12000-1-PBS targets CCL5/RANTES in WB, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2617 Product name: Recombinant human CCL5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-91 aa of BC008600 Sequence: MKVSAAALAVILIATALCAPASASPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS Predict reactive species |
| Full Name | chemokine (C-C motif) ligand 5 |
| Calculated Molecular Weight | 91 aa, 10 kDa |
| Observed Molecular Weight | 8 kDa |
| GenBank Accession Number | BC008600 |
| Gene Symbol | CCL5/RANTES |
| Gene ID (NCBI) | 6352 |
| RRID | AB_2877815 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P13501 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
RANTES (CCL5) belongs to the CC chemokine family and induces leukocyte migration by binding to specific receptors in the G protein-coupled receptor family. RANTES (CCL5) has been shown in vitro to mediate eosinophil, lymphocyte, neutrophil, and monocyte chemotaxis, and it initiates several other proinflammatory events, such as integrin activation, lipid mediator biosynthesis, and degranulation.



