Tested Applications
| Positive WB detected in | human peripheral blood platelets, PMA, LPS and Brefeldin A treated THP-1 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
12000-1-AP targets CCL5/RANTES in WB, IHC, IF, Neutralization, ELISA, Blocking assay applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2617 Product name: Recombinant human CCL5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-91 aa of BC008600 Sequence: MKVSAAALAVILIATALCAPASASPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS Predict reactive species |
| Full Name | chemokine (C-C motif) ligand 5 |
| Calculated Molecular Weight | 91 aa, 10 kDa |
| Observed Molecular Weight | 8 kDa |
| GenBank Accession Number | BC008600 |
| Gene Symbol | CCL5/RANTES |
| Gene ID (NCBI) | 6352 |
| RRID | AB_2877815 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P13501 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
RANTES (CCL5) belongs to the CC chemokine family and induces leukocyte migration by binding to specific receptors in the G protein-coupled receptor family. RANTES (CCL5) has been shown in vitro to mediate eosinophil, lymphocyte, neutrophil, and monocyte chemotaxis, and it initiates several other proinflammatory events, such as integrin activation, lipid mediator biosynthesis, and degranulation.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for CCL5/RANTES antibody 12000-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The CCL5/RANTES Polyclonal antibody (Cat# 12000-1-AP) has accumulated 23 citations in journals including Advanced Materials, Cell Death & Disease, Cell Reports, Molecular Therapy, Journal for ImmunoTherapy of Cancer, Brain, Behavior, and Immunity, Virulence, iScience, Stem Cells, and Journal of Immunology. Research fields encompass oncology (breast, colorectal, pancreatic, esophageal, colon, and prostate cancers), neurodegeneration (Alzheimer's disease), immunology (macrophage polarization, T cell infiltration), viral infection (CMV), hepatic fibrosis, bone regeneration, and diabetic nephropathy, utilizing IHC, WB, IF, and neutralization assays.
| Species | Application | Title |
|---|---|---|
Adv Mater Endogenous Metal Ion-Enriched Immunostimulating Biomimetic Scaffold Improves In Situ Bone Regeneration. | ||
Drug Resist Updat The combination of flaxseed lignans and PD-1/ PD-L1 inhibitor inhibits breast cancer growth via modulating gut microbiome and host immunity | ||
Research (Wash D C) PTBP2-Mediated Alternative Splicing of IRF9 Controls Tumor-Associated Monocyte/Macrophage Chemotaxis and Repolarization in Neuroblastoma Progression | ||
Cell Death Dis Tumor-derived exosomal CCT6A serves as a matchmaker introducing chemokines to tumor-associated macrophages in pancreatic ductal adenocarcinoma | ||
J Immunother Cancer Chordoma recruits and polarizes tumor-associated macrophages via secreting CCL5 to promote malignant progression | ||
Mol Ther Targeting S100A8/A9-NCF1 Axis in Tumor microenvironment to Prevent Tumor Metastasis by Self-assembled Peptide Nanofibers |
