Product Information
67010-1-PBS targets RASGRF1 in WB, Indirect ELISA applications and shows reactivity with rat, pig samples.
| Tested Reactivity | rat, pig |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag6937 Product name: Recombinant human RASGRF1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 832-1181 aa of BC040275 Sequence: QSDDGDTETSPTKSPTTPKSVKNKNSSEFPLFSYNNGVVMTSCRELDNNRSALSAASAFAIATAGANEGTPNKEKYRRMSLASAGFPPDQRNGDKEFVIRRAATNRVLNVLRHWVSKHSQDFETNDELKCKVIGFLEEVMHDPELLTQERKAAANIIRTLTQEDPGDNQITLEEITQMAEGVKAEPFENHSALEIAEQLTLLDHLVFKKIPYEEFFGQGWMKLEKNERTPYIMKTTKHFNDISNLIASEIIRNEDINARVSAIEKWVAVADICRCLHNYNAVLEITSSMNRSAIFRLKKTWLKVSKQVRAGGWHHCLPGAGLGLGQEDPWAGHWASTSGQRTGLRSNTPR Predict reactive species |
| Full Name | Ras protein-specific guanine nucleotide-releasing factor 1 |
| Calculated Molecular Weight | 134 kDa |
| Observed Molecular Weight | 145 kDa |
| GenBank Accession Number | BC040275 |
| Gene Symbol | RASGRF1 |
| Gene ID (NCBI) | 5923 |
| RRID | AB_2882327 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q13972 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
RasGRF1, a member of calmodulin-activated guanine-nucleotide exchange factors (GEFs), highly expressed at the synaptic junctions of the central nervous system (CNS). It is similar to the Saccharomyces cerevisiae CDC25. RASGRF1 serves as an in vivo activator for H-RAS and members of the R-RAS and RAC subfamilies. Several studies have shown that RasGRF1 also binds to microtubules and participate in the regulation of neurite outgrowth. RasGRF1 has been implicated in neuronal excitability. The studies of the similar gene in mouse suggested that the Ras-GEF activity of this protein in brain can be activated by Ca2+ influx, muscarinic receptors, and G protein beta-gamma subunit. Mouse studies also indicated that the Ras-GEF signaling pathway mediated by this protein may be important for long-term memory.







