RASGRF1 Monoclonal antibody

RASGRF1 Monoclonal Antibody for WB, ELISA
Cat No. 67010-1-Ig
Clone No.1A4D4

Host / Isotype

Mouse / IgG1

Reactivity

rat, pig

Applications

WB, ELISA

1A4D4, CDC25, CDC25L, GNRP, GRF1

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inpig cerebellum tissue, pig brain tissue, rat brain tissue, rat cerebellum tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67010-1-Ig targets RASGRF1 in WB, ELISA applications and shows reactivity with rat, pig samples.

Tested Reactivity rat, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag6937

Product name: Recombinant human RASGRF1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 832-1181 aa of BC040275

Sequence: QSDDGDTETSPTKSPTTPKSVKNKNSSEFPLFSYNNGVVMTSCRELDNNRSALSAASAFAIATAGANEGTPNKEKYRRMSLASAGFPPDQRNGDKEFVIRRAATNRVLNVLRHWVSKHSQDFETNDELKCKVIGFLEEVMHDPELLTQERKAAANIIRTLTQEDPGDNQITLEEITQMAEGVKAEPFENHSALEIAEQLTLLDHLVFKKIPYEEFFGQGWMKLEKNERTPYIMKTTKHFNDISNLIASEIIRNEDINARVSAIEKWVAVADICRCLHNYNAVLEITSSMNRSAIFRLKKTWLKVSKQVRAGGWHHCLPGAGLGLGQEDPWAGHWASTSGQRTGLRSNTPR

Predict reactive species
Full Name Ras protein-specific guanine nucleotide-releasing factor 1
Calculated Molecular Weight 134 kDa
Observed Molecular Weight 145 kDa
GenBank Accession NumberBC040275
Gene Symbol RASGRF1
Gene ID (NCBI) 5923
RRIDAB_2882327
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ13972
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RasGRF1, a member of calmodulin-activated guanine-nucleotide exchange factors (GEFs), highly expressed at the synaptic junctions of the central nervous system (CNS). It is similar to the Saccharomyces cerevisiae CDC25. RASGRF1 serves as an in vivo activator for H-RAS and members of the R-RAS and RAC subfamilies. Several studies have shown that RasGRF1 also binds to microtubules and participate in the regulation of neurite outgrowth. RasGRF1 has been implicated in neuronal excitability. The studies of the similar gene in mouse suggested that the Ras-GEF activity of this protein in brain can be activated by Ca2+ influx, muscarinic receptors, and G protein beta-gamma subunit. Mouse studies also indicated that the Ras-GEF signaling pathway mediated by this protein may be important for long-term memory.

Protocols

Product Specific Protocols
WB protocol for RASGRF1 antibody 67010-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...