RBAP48 Polyclonal antibody, PBS Only

• 

  WB analysis of HeLa using 14557-1-AP (same clone as 14557-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 14557-1-AP (RBAP48 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14557-1-PBS in a different storage buffer formulation.

• 

  WB analysis of K-562 using 14557-1-AP (same clone as 14557-1-PBS)

  K-562 cells were subjected to SDS PAGE followed by western blot with 14557-1-AP (RBAP48 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14557-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse thymus using 14557-1-AP (same clone as 14557-1-PBS)

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 14557-1-AP (RBAP48 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14557-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary using 14557-1-AP (same clone as 14557-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary using 14557-1-AP (RBAP48 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 14557-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary using 14557-1-AP (same clone as 14557-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary using 14557-1-AP (RBAP48 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 14557-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 14557-1-AP (same clone as 14557-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney using 14557-1-AP (RBAP48 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 14557-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 14557-1-AP (same clone as 14557-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney using 14557-1-AP (RBAP48 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 14557-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 14557-1-AP (same clone as 14557-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta using 14557-1-AP (RBAP48 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 14557-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 14557-1-AP (same clone as 14557-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta using 14557-1-AP (RBAP48 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 14557-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 14557-1-AP (same clone as 14557-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis using 14557-1-AP (RBAP48 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 14557-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 14557-1-AP (same clone as 14557-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis using 14557-1-AP (RBAP48 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 14557-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 14557-1-AP (same clone as 14557-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain using 14557-1-AP (RBAP48 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 14557-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 14557-1-AP (same clone as 14557-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain using 14557-1-AP (RBAP48 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 14557-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human spleen using 14557-1-AP (same clone as 14557-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human spleen using 14557-1-AP (RBAP48 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 14557-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human spleen using 14557-1-AP (same clone as 14557-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human spleen using 14557-1-AP (RBAP48 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 14557-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung using 14557-1-AP (same clone as 14557-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung using 14557-1-AP (RBAP48 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 14557-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung using 14557-1-AP (same clone as 14557-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung using 14557-1-AP (RBAP48 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 14557-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 14557-1-AP (same clone as 14557-1-PBS)

  Immunofluorescent analysis of (10% Formaldehyde) fixed HeLa cells using 14557-1-AP (RBAP48 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 14557-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 14557-1-AP (same clone as 14557-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using RBAP48 antibody (14557-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red). This data was developed using the same antibody clone with 14557-1-PBS in a different storage buffer formulation.

RBAP48 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 14557-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

RBBP4, NURF55, Nucleosome-remodeling factor subunit RBAP48, Histone-binding protein RBBP4, CAF-I p48

---

Product Information

14557-1-PBS targets RBAP48 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6110

  Product name: Recombinant human RBBP4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-425 aa of BC053904

  Sequence: MADKEAAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGSVDPEGQGS

• Full Name: retinoblastoma binding protein 4
• Calculated Molecular Weight: 48 kDa
• Observed Molecular Weight: 40 kDa, 48-53 kDa
• GenBank Accession Number: BC053904
• Gene Symbol: RBBP4
• Gene ID (NCBI): 5928
• RRID: AB_2177630
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q09028
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.