Product Information
85676-3-PBS targets RBPJ in WB, Indirect ELISA applications and shows reactivity with human, rat samples.
| Tested Reactivity | human, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag32552 Product name: Recombinant human RBPJ protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 380-486 aa of BC064976 Sequence: MYRCGESMLCVVPDISAFREGWRWVRQPVQVPVTLVRNDGIIYSTSLTFTYTPEPGPRPHCSAAGAILRANSSQVPPNESNTNSEGSYTNASTNSTSVTSSTATVVS Predict reactive species |
| Full Name | recombination signal binding protein for immunoglobulin kappa J region |
| Calculated Molecular Weight | 56 kDa |
| Observed Molecular Weight | ~60 kDa |
| GenBank Accession Number | BC064976 |
| Gene Symbol | RBPJ |
| Gene ID (NCBI) | 3516 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q06330 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
RBPJ, also named as IGKJRB, IGKJRB1, RBPJK, RBPSUH, NY-REN-30, CBF-1 and CSL, belongs to the Su(H) family. It is a transcriptional regulator that plays a central role in Notch signaling, a signaling pathway involved in cell-cell communication that regulates a broad spectrum of cell-fate determinations. RBPJ acts as a transcriptional repressor when it is not associated with Notch proteins. It is specifically binds to the immunoglobulin kappa-type J segment recombination signal sequence. RBPJ binds to the Runx3 promoter in the atrioventricular canal in vivo, and inhibition of Notch reduces RUNX3 expression in the cardiac cushion of embryonic hearts.

