RBPMS2 Polyclonal antibody

• 

  WB analysis using 32971-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32971-1-AP (RBPMS2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 32971-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32971-1-AP (RBPMS2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

RBPMS2 Polyclonal Antibody for WB, ELISA

Cat No. 32971-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

RNA binding protein, mRNA processing factor 2, RNA-binding protein with multiple splicing 2

---

Tested Applications

• Positive WB detected in: HepG2 cells, LNCaP cells, L02 cells, PC-3 cells, U2OS cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32971-1-AP targets RBPMS2 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag37616

  Product name: Recombinant human RBPMS2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 115-207 aa of NM_194272

  Sequence: SKLMATPNPSNVHPALGAHFIARDPYDLMGAALIPASPEAWAPYPLYTTELTPAISHAAFTYPTATAAAAALHAQVRWYPSSDTTQQGWKYRQFC

• Full Name: RNA binding protein with multiple splicing 2
• Calculated Molecular Weight: 22 kDa
• Observed Molecular Weight: 24 kDa, 26-29 kDa
• GenBank Accession Number: NM_194272
• Gene Symbol: RBPMS2
• Gene ID (NCBI): 348093
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q6ZRY4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RBPMS2 (RNA binding protein with multiple splicing 2) is an RNA binding protein, and its encoded protein is rich in RNA binding motifs, belonging to the family of RNA binding motifs, and has an RNA recognition motif (RRM) domain, which can bind with RNA molecules and participate in RNA regulation. RBPMS2 is abundant in myocardial cells and plays an important role in the development and function of myocardium. It can regulate the differentiation and proliferation of myocardial cells and maintain the normal function of myocardial cells. In gastric cancer, the expression level of RBPMS2 is related to lymph node metastasis, which can be used as a biomarker to predict the prognosis of gastric cancer.