RBX1 Monoclonal antibody

• 

  WB analysis using 66716-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66716-1-Ig (RBX1 antibody) at dilution of 1:50000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of RAW 264.7 using 66716-1-Ig

  RAW 264.7 cells were subjected to SDS PAGE followed by western blot with 66716-1-Ig (RBX1 antibody) at dilution of 1:50000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver cancer using 66716-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66716-1-Ig (RBX1 antibody) at dilution of 1:5000 (under 10x lens) Heat mediated antigen retrieved with Sodium Citrate buffer (pH 6.0).

• 

  IHC staining of human liver cancer using 66716-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66716-1-Ig (RBX1 antibody) at dilution of 1:5000 (under 40x lens) Heat mediated antigen retrieved with Sodium Citrate buffer (pH 6.0).

• 

  IF Staining of A431 using 66716-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using RBX1 antibody (66716-1-Ig, Clone: 1F4D9 ) at dilution of 1:2000 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (RGAM002), CL594-phalloidin (red).

RBX1 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 66716-1-Ig

Clone No.1F4D9

Publications(2)

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

Protein ZYP, EC:2.3.2.27, E3 ubiquitin-protein transferase RBX1, E3 ubiquitin-protein ligase RBX1, N-terminally processed, E3 ubiquitin-protein ligase RBX1

---

Tested Applications

• Positive WB detected in: HeLa cells, RAW 264.7 cells, HEK-293 cells, HepG2 cells, Jurkat cells
• Positive IHC detected in: human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:20000-1:50000
• Immunohistochemistry (IHC): IHC : 1:2500-1:10000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• IP: See 1 publications below

Product Information

66716-1-Ig targets RBX1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7005

  Product name: Recombinant human RBX1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-108 aa of BC001466

  Sequence: MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH

• Full Name: ring-box 1
• Calculated Molecular Weight: 12 kDa
• Observed Molecular Weight: 12-15 kDa
• GenBank Accession Number: BC001466
• Gene Symbol: RBX1
• Gene ID (NCBI): 9978
• RRID: AB_2882067
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P62877
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RBX1(RING-box protein 1) is also named as RNF75, ROC1 and is a requisite component of the multi- subunit SCF family E3s36-40. It mediates the ubiquitination and subsequent proteasomal degradation of target proteins, including proteins involved in cell cycle progression, signal transduction, transcription and transcription-coupled nucleotide excision repair.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Proc Natl Acad Sci U S A; The herpesvirus UL49.5 protein hijacks a cellular C-degron pathway to drive TAP transporter degradation; Authors - Magda Wąchalska
human	WB,IP	bioRxiv; The herpesvirus UL49.5 protein hijacks a cellular C-degron pathway to drive TAP transporter degradation; Authors - Magda Wąchalska