Tested Applications
Positive WB detected in | HeLa cells, RAW 264.7 cells, HEK-293 cells, HepG2 cells, Jurkat cells |
Positive IHC detected in | human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | A431 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:20000-1:50000 |
Immunohistochemistry (IHC) | IHC : 1:2500-1:10000 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:1000-1:4000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 2 publications below |
IP | See 1 publications below |
Product Information
66716-1-Ig targets RBX1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag7005 Product name: Recombinant human RBX1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-108 aa of BC001466 Sequence: MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH Predict reactive species |
Full Name | ring-box 1 |
Calculated Molecular Weight | 12 kDa |
Observed Molecular Weight | 12-15 kDa |
GenBank Accession Number | BC001466 |
Gene Symbol | RBX1 |
Gene ID (NCBI) | 9978 |
RRID | AB_2882067 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein G purification |
UNIPROT ID | P62877 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
RBX1(RING-box protein 1) is also named as RNF75, ROC1 and is a requisite component of the multi- subunit SCF family E3s36-40. It mediates the ubiquitination and subsequent proteasomal degradation of target proteins, including proteins involved in cell cycle progression, signal transduction, transcription and transcription-coupled nucleotide excision repair.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for RBX1 antibody 66716-1-Ig | Download protocol |
IHC protocol for RBX1 antibody 66716-1-Ig | Download protocol |
IF protocol for RBX1 antibody 66716-1-Ig | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Proc Natl Acad Sci U S A The herpesvirus UL49.5 protein hijacks a cellular C-degron pathway to drive TAP transporter degradation | ||
bioRxiv The herpesvirus UL49.5 protein hijacks a cellular C-degron pathway to drive TAP transporter degradation |