Tested Applications
| Positive WB detected in | HeLa cells, RAW 264.7 cells, HEK-293 cells, HepG2 cells, Jurkat cells |
| Positive IHC detected in | human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A431 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:20000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:2500-1:10000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:1000-1:4000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66716-1-Ig targets RBX1 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag7005 Product name: Recombinant human RBX1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-108 aa of BC001466 Sequence: MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH Predict reactive species |
| Full Name | ring-box 1 |
| Calculated Molecular Weight | 12 kDa |
| Observed Molecular Weight | 12-15 kDa |
| GenBank Accession Number | BC001466 |
| Gene Symbol | RBX1 |
| Gene ID (NCBI) | 9978 |
| RRID | AB_2882067 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P62877 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
RBX1(RING-box protein 1) is also named as RNF75, ROC1 and is a requisite component of the multi- subunit SCF family E3s36-40. It mediates the ubiquitination and subsequent proteasomal degradation of target proteins, including proteins involved in cell cycle progression, signal transduction, transcription and transcription-coupled nucleotide excision repair.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for RBX1 antibody 66716-1-Ig | Download protocol |
| IHC protocol for RBX1 antibody 66716-1-Ig | Download protocol |
| WB protocol for RBX1 antibody 66716-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The RBX1 Monoclonal antibody (catalog number 66716-1-Ig) has 5 total citations. These appear in Pharmacological Research, Proceedings of the National Academy of Sciences (PNAS), Oncogene, and bioRxiv. The associated research fields span cancer therapy (targeting the NEDD8 conjugating enzyme UBC12), herpesvirus pathogenesis (UL49.5-mediated TAP transporter degradation), renal cell carcinoma signaling (LRRK2 and TKI/PD-1 resistance), and ubiquitin-proteasome biology (E3 ligase recruitment by UBQLN2). Applications include immunofluorescence, Western blot, and co-immunoprecipitation.
| Species | Application | Title |
|---|---|---|
Proc Natl Acad Sci U S A The herpesvirus UL49.5 protein hijacks a cellular C-degron pathway to drive TAP transporter degradation | ||
Oncogene LRRK2 reduces the sensitivity to TKI and PD-1 blockade in ccRCC via activating LPCAT1
| ||
bioRxiv The herpesvirus UL49.5 protein hijacks a cellular C-degron pathway to drive TAP transporter degradation |
