RBX1 Monoclonal antibody, PBS Only

• 

  WB analysis using 66716-1-Ig (same clone as 66716-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66716-1-Ig (RBX1 antibody) at dilution of 1:50000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66716-1-PBS in a different storage buffer formulation.

• 

  WB analysis of RAW 264.7 using 66716-1-Ig (same clone as 66716-1-PBS)

  RAW 264.7 cells were subjected to SDS PAGE followed by western blot with 66716-1-Ig (RBX1 antibody) at dilution of 1:50000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66716-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 66716-1-Ig (same clone as 66716-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66716-1-Ig (RBX1 antibody) at dilution of 1:5000 (under 10x lens) Heat mediated antigen retrieved with Sodium Citrate buffer (pH 6.0). This data was developed using the same antibody clone with 66716-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 66716-1-Ig (same clone as 66716-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66716-1-Ig (RBX1 antibody) at dilution of 1:5000 (under 40x lens) Heat mediated antigen retrieved with Sodium Citrate buffer (pH 6.0). This data was developed using the same antibody clone with 66716-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 66716-1-Ig (same clone as 66716-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using RBX1 antibody (66716-1-Ig, Clone: 1F4D9 ) at dilution of 1:2000 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (RGAM002), CL594-phalloidin (red). This data was developed using the same antibody clone with 66716-1-PBS in a different storage buffer formulation.

RBX1 Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 66716-1-PBS

Clone No.1F4D9

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

Protein ZYP, EC:2.3.2.27, E3 ubiquitin-protein transferase RBX1, E3 ubiquitin-protein ligase RBX1, N-terminally processed, E3 ubiquitin-protein ligase RBX1

---

Product Information

66716-1-PBS targets RBX1 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7005

  Product name: Recombinant human RBX1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-108 aa of BC001466

  Sequence: MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH

• Full Name: ring-box 1
• Calculated Molecular Weight: 12 kDa
• Observed Molecular Weight: 12-15 kDa
• GenBank Accession Number: BC001466
• Gene Symbol: RBX1
• Gene ID (NCBI): 9978
• RRID: AB_2882067
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P62877
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

RBX1(RING-box protein 1) is also named as RNF75, ROC1 and is a requisite component of the multi- subunit SCF family E3s36-40. It mediates the ubiquitination and subsequent proteasomal degradation of target proteins, including proteins involved in cell cycle progression, signal transduction, transcription and transcription-coupled nucleotide excision repair.