SLC1A5/ASCT2 Monoclonal antibody

SLC1A5/ASCT2 Monoclonal Antibody for WB, IHC, IF/ICC, IF-Fro, FC (Intra), ELISA

Cat No. 68540-1-Ig
Clone No.1C4E1

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, IF/ICC, IF-Fro, FC (Intra), ELISA

SLC1A5, 1C4E1, AAAT, ASCT2, ATB(0)

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA431 cells, PNGase F-treated A431 cells, A549 cells, PNGase F-treated A549 cells, HT-29 cells, PNGase F-treated HT-29 cells
Positive IHC detected inhuman stomach cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-Fro detected inmouse small intestine tissue
Positive IF/ICC detected inHEK-293 cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:1000-1:4000
Immunofluorescence (IF)-FROIF-FRO : 1:1000-1:4000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

68540-1-Ig targets SLC1A5/ASCT2 in WB, IHC, IF/ICC, IF-Fro, FC (Intra), ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag16837

Product name: Recombinant human RDRC protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 436-541 aa of BC000062

Sequence: VLTLAIILEAVNLPVDHISLILAVDWLVDRSCTVLNVEGDALGAGLLQNYVDRTESRSTEPELIQVKSELPLDPLPLPTEEGNPLLKHYRGPAGDATVASEKESVM

Predict reactive species
Full Name solute carrier family 1 (neutral amino acid transporter), member 5
Calculated Molecular Weight 541 aa, 57 kDa
Observed Molecular Weight 55-70 kDa
GenBank Accession NumberBC000062
Gene Symbol SLC1A5/ASCT2
Gene ID (NCBI) 6510
RRIDAB_3085248
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ15758
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SLC1A5 (Solute Carrier Family 1, member 5), also named as ASCT2, a major glutamine transporter belonging to the SLC1 family and localized in the plasma membrane of several body districts. Consistent with the functions exerted by glutamine, SLC1A5 is involved in uptake of essential amino acids, activation of mTORC1 and glutamine-dependent tumor cell survival and growth. SLC1A5 is highly expressed in various malignancies and plays a critical role in the transformation, growth and survival of cancer cells (PMID: 30234109). High SLC1A5 expression is associated with poor prognosis in clear-cell renal cell carcinoma (PMID: 26599282).

Protocols

Product Specific Protocols
FC protocol for SLC1A5/ASCT2 antibody 68540-1-IgDownload protocol
IF protocol for SLC1A5/ASCT2 antibody 68540-1-IgDownload protocol
IHC protocol for SLC1A5/ASCT2 antibody 68540-1-IgDownload protocol
WB protocol for SLC1A5/ASCT2 antibody 68540-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...