REG Polyclonal antibody

• 

  WB analysis using 33428-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33428-1-AP (Reg1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

REG Polyclonal Antibody for WB, ELISA

Cat No. 33428-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, ELISA

Synonyms

Islet of Langerhans regenerating protein 1, Lithostathine-1, Pancreatic stone protein 1, Pancreatic thread protein 1, PSP

---

Tested Applications

• Positive WB detected in: mouse pancreas tissue, rat pancreas tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33428-1-AP targets REG in WB, ELISA applications and shows reactivity with mouse, rat samples.

• Tested Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Eg6797

  Product name: Recombinant mouse Reg1 protein

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 22-165 aa of NM_009042.1

  Sequence: QEAEEDLPSARISCPEGSNAYSSYCYYFTEDRLTWADADLFCQNMNSGYLVSVLSQAEGNFVASLIKESGTTDANVWTGLHDPKRNRRWHWSSGSLFLYKSWATGSPNSSNRGYCVSLTSNTGYKKWKDDNCDAQYSFVCKFKG

• Full Name: regenerating islet-derived 1
• Calculated Molecular Weight: 19 kDa
• Observed Molecular Weight: 16 kDa
• GenBank Accession Number: NM_009042.1
• Gene Symbol: Reg1
• Gene ID (NCBI): 19692
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P43137
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The Reg gene family is a multigene family grouped into four subclasses, types I, II, III and IV, based on the primary structures of the encoded proteins. This gene encodes a protein that is secreted by the exocrine pancreas. It is associated with islet cell regeneration and diabetogenesis and may be involved in pancreatic lithogenesis. It's reported that REG1A was significantly upregulated in tumor specimens and adenoma as compared to normal colorectal tissue. (PMID: 34698109)