Tested Applications
| Positive WB detected in | mouse pancreas tissue, rat pancreas tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
33428-1-AP targets REG in WB, ELISA applications and shows reactivity with mouse, rat samples.
| Tested Reactivity | mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Eg6797 Product name: Recombinant mouse Reg1 protein Source: mammalian cells-derived, V37 Tag: C-rFc Domain: 22-165 aa of NM_009042.1 Sequence: QEAEEDLPSARISCPEGSNAYSSYCYYFTEDRLTWADADLFCQNMNSGYLVSVLSQAEGNFVASLIKESGTTDANVWTGLHDPKRNRRWHWSSGSLFLYKSWATGSPNSSNRGYCVSLTSNTGYKKWKDDNCDAQYSFVCKFKG Predict reactive species |
| Full Name | regenerating islet-derived 1 |
| Calculated Molecular Weight | 19 kDa |
| Observed Molecular Weight | 16 kDa |
| GenBank Accession Number | NM_009042.1 |
| Gene Symbol | Reg1 |
| Gene ID (NCBI) | 19692 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | P43137 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The Reg gene family is a multigene family grouped into four subclasses, types I, II, III and IV, based on the primary structures of the encoded proteins. This gene encodes a protein that is secreted by the exocrine pancreas. It is associated with islet cell regeneration and diabetogenesis and may be involved in pancreatic lithogenesis. It's reported that REG1A was significantly upregulated in tumor specimens and adenoma as compared to normal colorectal tissue. (PMID: 34698109)
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for REG antibody 33428-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

